KEGG   Shewanella piezotolerans WP3: swp_1542Help
Entry
swp_1542          CDS       T00791                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:swp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:swp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587672..1588814
Genome map
AA seq 380 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVSQDPELEVVGTAVNGAEAVKLAAELKPQVITMDIEMPV
MDGITAVKQIMASNPLPILMFSSLTHDGAKATLDALEAGALDFLPKRFEDIATNKDDAIA
LLQQRIKTLGRRRLFRPAIRPSPTAVKPRVTSAPTVALTRTAASSIPAQSLVTDKPTSRS
TAVTRASGKKYKALLIGTSTGGPVALQKVLTQFPANYPHPILLIQHMPAAFTPTFATRLN
SLCKIEVKEAQTGDQLRAGCAYLAPGGMQMMLERSGSFGRIKVLAGKPEMNYKPSVDITF
ASASKLLGGDVLAVVLTGMGADGREGARMLKSAGANIWAQDEASCVVYGMPQAVTNAGLA
TKSISIEQMAESILKETAHG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagtactagttgtcgacgattcaagttttttccggcgacgcgtaagtgag
attgtcagtcaagatccagagttagaagtggttggcactgcggttaacggtgctgaagct
gttaagcttgcggcagagcttaagccgcaagtgataaccatggatattgagatgccagtg
atggacgggatcacagcggttaagcaaataatggccagtaatccgctgccaattctgatg
ttttcatcattgacgcatgacggcgccaaagcaacattagatgcgctggaggcaggtgca
cttgattttctgccaaaacgattcgaagacattgccactaataaagacgatgcaattgca
ttattgcagcaacgcattaaaaccttaggtcgccgccgtttatttaggccagctattcgg
ccatcaccaactgcggttaaaccgcgagtaacttcggcacctacggtagcattaacacgt
acagcggcttcaagtataccagcacaatcattggtaactgataaacccactagtcgttca
accgcagtcactcgtgcaagtggtaaaaagtataaggccttacttattggtacctcgact
ggaggaccggtagcactacaaaaagtgttaacccaatttccggcaaattacccgcaccct
attttacttattcaacatatgcctgctgcatttacgccgacatttgcgactcgtttaaat
agcttgtgcaaaattgaagtaaaagaagcgcaaactggcgaccaactgcgtgccggatgc
gcgtatctggcacctggcggcatgcagatgatgcttgagcgtagtggcagttttggtcgt
attaaagtactcgcaggcaaaccagagatgaattataagcccagtgttgacatcaccttt
gcgtcagcatctaagttattgggtggcgatgtattagcggtggtgcttactggtatggga
gcagacggtcgcgaaggcgcgcgtatgcttaagtctgcgggtgctaatatctgggcgcaa
gacgaggccagttgtgtggtttacggcatgccgcaagccgtaaccaatgctggattagcg
actaaatcaattagtattgaacagatggccgagtcaatcctcaaagagacggcacatggc
taa

DBGET integrated database retrieval system