KEGG   Shewanella piezotolerans: swp_1542Help
Entry
swp_1542          CDS       T00791                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
swp  Shewanella piezotolerans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:swp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    swp_1542
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    swp_1542
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     swp_1542
Two-component system [BR:swp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   swp_1542
Bacterial motility proteins [BR:swp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    swp_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587672..1588814
Genome map
AA seq 380 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVSQDPELEVVGTAVNGAEAVKLAAELKPQVITMDIEMPV
MDGITAVKQIMASNPLPILMFSSLTHDGAKATLDALEAGALDFLPKRFEDIATNKDDAIA
LLQQRIKTLGRRRLFRPAIRPSPTAVKPRVTSAPTVALTRTAASSIPAQSLVTDKPTSRS
TAVTRASGKKYKALLIGTSTGGPVALQKVLTQFPANYPHPILLIQHMPAAFTPTFATRLN
SLCKIEVKEAQTGDQLRAGCAYLAPGGMQMMLERSGSFGRIKVLAGKPEMNYKPSVDITF
ASASKLLGGDVLAVVLTGMGADGREGARMLKSAGANIWAQDEASCVVYGMPQAVTNAGLA
TKSISIEQMAESILKETAHG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagtactagttgtcgacgattcaagttttttccggcgacgcgtaagtgag
attgtcagtcaagatccagagttagaagtggttggcactgcggttaacggtgctgaagct
gttaagcttgcggcagagcttaagccgcaagtgataaccatggatattgagatgccagtg
atggacgggatcacagcggttaagcaaataatggccagtaatccgctgccaattctgatg
ttttcatcattgacgcatgacggcgccaaagcaacattagatgcgctggaggcaggtgca
cttgattttctgccaaaacgattcgaagacattgccactaataaagacgatgcaattgca
ttattgcagcaacgcattaaaaccttaggtcgccgccgtttatttaggccagctattcgg
ccatcaccaactgcggttaaaccgcgagtaacttcggcacctacggtagcattaacacgt
acagcggcttcaagtataccagcacaatcattggtaactgataaacccactagtcgttca
accgcagtcactcgtgcaagtggtaaaaagtataaggccttacttattggtacctcgact
ggaggaccggtagcactacaaaaagtgttaacccaatttccggcaaattacccgcaccct
attttacttattcaacatatgcctgctgcatttacgccgacatttgcgactcgtttaaat
agcttgtgcaaaattgaagtaaaagaagcgcaaactggcgaccaactgcgtgccggatgc
gcgtatctggcacctggcggcatgcagatgatgcttgagcgtagtggcagttttggtcgt
attaaagtactcgcaggcaaaccagagatgaattataagcccagtgttgacatcaccttt
gcgtcagcatctaagttattgggtggcgatgtattagcggtggtgcttactggtatggga
gcagacggtcgcgaaggcgcgcgtatgcttaagtctgcgggtgctaatatctgggcgcaa
gacgaggccagttgtgtggtttacggcatgccgcaagccgtaaccaatgctggattagcg
actaaatcaattagtattgaacagatggccgagtcaatcctcaaagagacggcacatggc
taa

DBGET integrated database retrieval system