KEGG   Shewanella piezotolerans: swp_1649Help
Entry
swp_1649          CDS       T00791                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
swp  Shewanella piezotolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    swp_1649
   00052 Galactose metabolism
    swp_1649
   00500 Starch and sucrose metabolism
    swp_1649
   00520 Amino sugar and nucleotide sugar metabolism
    swp_1649
Enzymes [BR:swp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     swp_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705081..1705986)
Genome map
AA seq 301 aa AA seqDB search
MKQHKIKKAVIPVAGLGTRMLPATKAMPKEMLPVMDKPLIQYVVKEAIAAGIKEIVLVTH
ASKNSVENHFDTSFELEAHLERRVKRQLLAEVQSICPADVTIISVRQAQAKGLGHAILCA
KTIVGDAPFAVLLPDVIVDDSSSNLAKDNLAQMVKLFDETEVGQIMVEGVPHDQVDQYGI
ADINGEELQPGESLPLSQLVEKPAVEEAPSNLGVVGRYVLPADIWSYLAKTPAGAGDEIQ
LTDAIAMLMENQTVNAYYMQGKSHDCGNKLGYMQANVEHALRHKDIGPEFAEYIKSIAKS
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataagattaaaaaagcagtaatcccagttgcaggccttggtacacggatg
ctaccagcgacaaaagcaatgcctaaagagatgctgccagtgatggataaaccccttatc
caatatgttgtcaaagaagcaattgctgcgggtattaaagagatcgttttagtcactcac
gccagtaaaaactcagtcgagaaccacttcgacaccagctttgagttagaagcccatcta
gagcgccgggtaaaacgtcaacttcttgcagaagtacaaagcatttgccctgcagacgtt
accatcattagtgtgcgtcaagcccaggcaaaaggcttaggtcatgcaattttatgtgcc
aagactattgtgggtgatgcgccatttgcagtgctgttaccagatgtgattgtcgatgat
tctagcagtaacttagcgaaagataatttggcacagatggtaaagctatttgatgaaacc
gaagtaggccaaatcatggtagaaggcgtgcctcatgatcaggttgatcaatacggtatt
gcagacatcaatggcgaagagttacagccaggggagtcattaccactaagtcagctagtt
gaaaagccagcggttgaggaagcaccatcaaaccttggtgtggttggccgatacgtgctg
ccagcagatatttggtcttacctagctaaaacaccagccggcgcaggcgatgagatccag
ttaaccgacgcgatagcgatgctgatggaaaatcaaaccgttaacgcttattacatgcaa
ggtaagagtcatgattgcggtaataaactcggctatatgcaagccaacgtagagcacgct
ttgcgccacaaggatataggcccagagtttgctgaatatattaagtctatcgctaaaagc
ctttag

DBGET integrated database retrieval system