KEGG   Shewanella piezotolerans WP3: swp_1649Help
Entry
swp_1649          CDS       T00791                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:swp00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:swp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:swp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:swp00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705081..1705986)
Genome map
AA seq 301 aa AA seqDB search
MKQHKIKKAVIPVAGLGTRMLPATKAMPKEMLPVMDKPLIQYVVKEAIAAGIKEIVLVTH
ASKNSVENHFDTSFELEAHLERRVKRQLLAEVQSICPADVTIISVRQAQAKGLGHAILCA
KTIVGDAPFAVLLPDVIVDDSSSNLAKDNLAQMVKLFDETEVGQIMVEGVPHDQVDQYGI
ADINGEELQPGESLPLSQLVEKPAVEEAPSNLGVVGRYVLPADIWSYLAKTPAGAGDEIQ
LTDAIAMLMENQTVNAYYMQGKSHDCGNKLGYMQANVEHALRHKDIGPEFAEYIKSIAKS
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataagattaaaaaagcagtaatcccagttgcaggccttggtacacggatg
ctaccagcgacaaaagcaatgcctaaagagatgctgccagtgatggataaaccccttatc
caatatgttgtcaaagaagcaattgctgcgggtattaaagagatcgttttagtcactcac
gccagtaaaaactcagtcgagaaccacttcgacaccagctttgagttagaagcccatcta
gagcgccgggtaaaacgtcaacttcttgcagaagtacaaagcatttgccctgcagacgtt
accatcattagtgtgcgtcaagcccaggcaaaaggcttaggtcatgcaattttatgtgcc
aagactattgtgggtgatgcgccatttgcagtgctgttaccagatgtgattgtcgatgat
tctagcagtaacttagcgaaagataatttggcacagatggtaaagctatttgatgaaacc
gaagtaggccaaatcatggtagaaggcgtgcctcatgatcaggttgatcaatacggtatt
gcagacatcaatggcgaagagttacagccaggggagtcattaccactaagtcagctagtt
gaaaagccagcggttgaggaagcaccatcaaaccttggtgtggttggccgatacgtgctg
ccagcagatatttggtcttacctagctaaaacaccagccggcgcaggcgatgagatccag
ttaaccgacgcgatagcgatgctgatggaaaatcaaaccgttaacgcttattacatgcaa
ggtaagagtcatgattgcggtaataaactcggctatatgcaagccaacgtagagcacgct
ttgcgccacaaggatataggcccagagtttgctgaatatattaagtctatcgctaaaagc
ctttag

DBGET integrated database retrieval system