KEGG   Shewanella piezotolerans WP3: swp_1731Help
Entry
swp_1731          CDS       T00791                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
swp  Shewanella piezotolerans WP3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:swp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780446..1781045
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQSLKCLPGVGPKSAQRMAFQLLERDRKAGSKLADSLGKAMSEVGHCQSC
RTFTEETYCPICVSTKRGHSSVICVVETPADVLAIEAGGHFSGRYFVLLGHLSPLDGVGP
DELGLALLETHLASGEVTELILATNPTVEGDATAHYIADMAKNHELAVSRIAHGVPVGGE
LEYVDSTTLALSFNGRLPI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtcctcttgttgatgagttgatccagtcacttaaatgcttacctggtgta
ggaccaaaatcagcacagcgcatggcatttcagctattagagcgtgatcgcaaggcggga
agtaagcttgcagattctctcggtaaagcgatgtctgaagtcggccattgtcagtcttgt
cgtacttttaccgaagaaacgtactgcccaatttgtgttagtaccaagcgtggccactca
agtgtgatctgtgtggtcgagacacctgctgatgttttggccattgaagctggtggacac
ttctcaggacgttactttgtgttacttggtcacctgtcaccacttgatggggtgggacct
gatgaattgggcttggcactgttagaaacgcatttggcgtcaggagaggtgacagaactc
attttggcgactaacccaaccgttgaaggtgacgctactgcgcactatattgccgatatg
gcaaagaatcatgagttagccgtcagccgcattgcgcatggtgtgccagtgggtggggag
cttgaatatgtggatagcaccactttagccttgtcttttaatggacgcttacccatttaa

DBGET integrated database retrieval system