KEGG   Shewanella piezotolerans: swp_1731Help
Entry
swp_1731          CDS       T00791                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
swp  Shewanella piezotolerans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:swp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    swp_1731 (recR)
DNA repair and recombination proteins [BR:swp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      swp_1731 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780446..1781045
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQSLKCLPGVGPKSAQRMAFQLLERDRKAGSKLADSLGKAMSEVGHCQSC
RTFTEETYCPICVSTKRGHSSVICVVETPADVLAIEAGGHFSGRYFVLLGHLSPLDGVGP
DELGLALLETHLASGEVTELILATNPTVEGDATAHYIADMAKNHELAVSRIAHGVPVGGE
LEYVDSTTLALSFNGRLPI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtcctcttgttgatgagttgatccagtcacttaaatgcttacctggtgta
ggaccaaaatcagcacagcgcatggcatttcagctattagagcgtgatcgcaaggcggga
agtaagcttgcagattctctcggtaaagcgatgtctgaagtcggccattgtcagtcttgt
cgtacttttaccgaagaaacgtactgcccaatttgtgttagtaccaagcgtggccactca
agtgtgatctgtgtggtcgagacacctgctgatgttttggccattgaagctggtggacac
ttctcaggacgttactttgtgttacttggtcacctgtcaccacttgatggggtgggacct
gatgaattgggcttggcactgttagaaacgcatttggcgtcaggagaggtgacagaactc
attttggcgactaacccaaccgttgaaggtgacgctactgcgcactatattgccgatatg
gcaaagaatcatgagttagccgtcagccgcattgcgcatggtgtgccagtgggtggggag
cttgaatatgtggatagcaccactttagccttgtcttttaatggacgcttacccatttaa

DBGET integrated database retrieval system