KEGG   Shewanella piezotolerans: swp_1749Help
Entry
swp_1749          CDS       T00791                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
swp  Shewanella piezotolerans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    swp_1749
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    swp_1749
Enzymes [BR:swp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     swp_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801632..1802627
Genome map
AA seq 331 aa AA seqDB search
MLDVESTILSDAEREQLSHPMIGGLILFSRNYTNRSQLIQLVQSIRAVRADILIAVDQEG
GRVQRFRDDFTVLPAMGDILPAAQGDLSLATTWATELGFLMAIELLAVDIDLSFAPVLDL
NGISQVIGKRSFSCDKAEVEQLATAFIKGMEQAGMASVGKHFPGHGSVEADSHIAKPVDL
RSKEQIFANDMQPFKQLITKERLQGIMPAHVIYPNVDANPAGFSPYWLQDVLRKELGFNG
VIFSDDLGMKGAAVAGSYCERAQAAIDAGCNMVLVCNDSFGATEVLHGVNWPKGEQSVAA
NRLKPDLKTVAKALQDSERWEKAKVIAATIL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgttgaatcaacaattttgagcgatgcagagcgtgagcaactgtcccaccca
atgattggtggacttattttgtttagccgaaattacactaaccgcagccaacttatacag
cttgttcagtcaataagagccgttcgtgctgacatcttaattgccgtcgaccaagagggt
ggtcgagtgcagcgctttagggatgactttacagttttacctgcgatgggagatatattg
ccagcagcgcagggagatctgtctctagcaacgacttgggcgacagaacttggcttttta
atggcgatagagttgttagctgttgatattgatttgagctttgcgccagtacttgatctt
aatggcattagccaagtgattggcaaacgtagctttagttgtgataaagctgaagtcgag
cagctcgcgacggcatttataaaaggcatggagcaagctggcatggcaagtgtgggcaaa
cactttcctggacacggcagtgtggaggcggattcccatattgccaagcccgttgattta
agaagcaaagaacagatatttgctaatgatatgcaacctttcaagcagcttattactaaa
gagagattacaagggatcatgcctgcgcatgttatctaccccaatgtagatgctaatcct
gcaggcttttcaccctattggctacaggatgttctgcgaaaagaattaggcttcaacggg
gtgattttttcagatgatctcggtatgaaaggcgctgctgttgctggcagttattgtgag
cgagcacaagcggccatcgatgcaggttgtaacatggtgttggtatgtaacgacagtttt
ggtgctaccgaagtactgcatggggttaattggccgaaaggggagcaaagtgtggctgcg
aataggttaaaaccagatttgaaaactgtcgccaaagctttgcaagatagcgagcgttgg
gaaaaagcaaaagtaattgctgcaactattctatag

DBGET integrated database retrieval system