KEGG   Shewanella piezotolerans WP3: swp_1749Help
Entry
swp_1749          CDS       T00791                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
swp  Shewanella piezotolerans WP3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:swp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:swp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801632..1802627
Genome map
AA seq 331 aa AA seqDB search
MLDVESTILSDAEREQLSHPMIGGLILFSRNYTNRSQLIQLVQSIRAVRADILIAVDQEG
GRVQRFRDDFTVLPAMGDILPAAQGDLSLATTWATELGFLMAIELLAVDIDLSFAPVLDL
NGISQVIGKRSFSCDKAEVEQLATAFIKGMEQAGMASVGKHFPGHGSVEADSHIAKPVDL
RSKEQIFANDMQPFKQLITKERLQGIMPAHVIYPNVDANPAGFSPYWLQDVLRKELGFNG
VIFSDDLGMKGAAVAGSYCERAQAAIDAGCNMVLVCNDSFGATEVLHGVNWPKGEQSVAA
NRLKPDLKTVAKALQDSERWEKAKVIAATIL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgttgaatcaacaattttgagcgatgcagagcgtgagcaactgtcccaccca
atgattggtggacttattttgtttagccgaaattacactaaccgcagccaacttatacag
cttgttcagtcaataagagccgttcgtgctgacatcttaattgccgtcgaccaagagggt
ggtcgagtgcagcgctttagggatgactttacagttttacctgcgatgggagatatattg
ccagcagcgcagggagatctgtctctagcaacgacttgggcgacagaacttggcttttta
atggcgatagagttgttagctgttgatattgatttgagctttgcgccagtacttgatctt
aatggcattagccaagtgattggcaaacgtagctttagttgtgataaagctgaagtcgag
cagctcgcgacggcatttataaaaggcatggagcaagctggcatggcaagtgtgggcaaa
cactttcctggacacggcagtgtggaggcggattcccatattgccaagcccgttgattta
agaagcaaagaacagatatttgctaatgatatgcaacctttcaagcagcttattactaaa
gagagattacaagggatcatgcctgcgcatgttatctaccccaatgtagatgctaatcct
gcaggcttttcaccctattggctacaggatgttctgcgaaaagaattaggcttcaacggg
gtgattttttcagatgatctcggtatgaaaggcgctgctgttgctggcagttattgtgag
cgagcacaagcggccatcgatgcaggttgtaacatggtgttggtatgtaacgacagtttt
ggtgctaccgaagtactgcatggggttaattggccgaaaggggagcaaagtgtggctgcg
aataggttaaaaccagatttgaaaactgtcgccaaagctttgcaagatagcgagcgttgg
gaaaaagcaaaagtaattgctgcaactattctatag

DBGET integrated database retrieval system