KEGG   Shewanella piezotolerans: swp_1842Help
Entry
swp_1842          CDS       T00791                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
swp  Shewanella piezotolerans
Pathway
swp00010  Glycolysis / Gluconeogenesis
swp00620  Pyruvate metabolism
swp00640  Propanoate metabolism
swp00680  Methane metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_1842
   00620 Pyruvate metabolism
    swp_1842
   00640 Propanoate metabolism
    swp_1842
  Energy metabolism
   00680 Methane metabolism
    swp_1842
Enzymes [BR:swp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     swp_1842
Lipid biosynthesis proteins [BR:swp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   swp_1842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACJ28604
UniProt: B8CLF3
Position
complement(1892121..1894073)
Genome map
AA seq 650 aa AA seqDB search
MSMQSLYKVPSEIAANALVNDEQYKKMYQESIVNPEGFWREHGNRIDWMKPFTKVKKTSF
DDHNLFIKWFYDGTLNASANCLDRHLENNADKVAIIWEGDDAKDQRTITYGELHADVCKF
ANALRSQGVRRGDVVTVYMPMVPEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNS
KVVITADEGVRAGRIIPLKANIDEALSHPDVDCIEKVIVMKRTGGDINWVEGRDIWWESL
METASEHCVPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKDGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPSPARLGEMIDRHNVNILYTAPTL
IRALMAEGKEQFNGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIVEGANEGNLVILDSWPGQMRTVFGD
HDRFVLTYFKTFRGMYFTGDGAKRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHE
QVAEAAVVGYPHDIKGQGIYAYVTLTRGTVETEELRQELRQWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIESRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcagtctctctacaaagttccaagtgaaatcgcagccaatgcacttgtaaat
gacgaacaatataaaaaaatgtatcaggagtcgattgtaaaccctgaaggtttctggaga
gaacacggcaaccgtatcgattggatgaaaccctttactaaagtaaagaaaacgtcgttc
gatgaccataacttgttcattaaatggttctatgatggcacgcttaacgcgtcagccaac
tgcctagacagacatttagaaaataatgccgacaaagtggctattatctgggaaggcgat
gacgcaaaagatcagcgtactatcacctatggtgagttgcatgctgatgtatgtaagttt
gctaacgcccttcgcagccaaggcgtaagacgcggagacgtagtaacagtttatatgcct
atggtgccagaagccgcagttgccatgcttgcctgtgcgcgcattggcgctatccactct
gtggtatttggtggtttctcacccgattctatcgcctcacgcgtcattgatggtaactcg
aaagttgtcattactgctgatgaaggtgttcgcgcaggccgtattatcccgcttaaagct
aatatcgatgaagcactatcccaccctgatgttgattgtattgaaaaagtcatcgtaatg
aagcgtactggcggcgacatcaactgggtcgaaggtcgtgatatctggtgggaatcttta
atggaaacggcctccgagcattgtgttccagaagagatgggcgctgaagatccgctattt
ttactctatacctctggctcaaccggtaaccctaaaggtgtgttacacactacaggcggt
tatatggtttacgctgcgatgactcacgaatatgtcttcgattataaagacggggaagtg
tattggtgtaccgcggatgtcggttggatcaccgggcactcatacatggtttatgggcca
cttgctaatggcgctaccgtgttaatccacgaaggtgtgcctaactatccaagtccagct
cgcttaggtgaaatgattgaccgacataatgtcaatatcctctataccgctcccacgctt
attcgtgcgttaatggccgaaggtaaagagcagttcaatggtttcgacggcagttcactg
cgcataatgggctcagttggagaaccgattaaccctgaagcatggcgctggtataacgat
gtaattggtcatgagaaatgccctatcgttgatacgtggtggcaaacagaaactggcggt
attttgattagcccactaccaggtgctacagatactaaacctggctcagcaactcgtcca
ttttttggtgtacagccagcacttgttgacaacatgggcaatatcgtagaaggggcgaat
gaaggaaacctagtgattcttgattcatggcctggacagatgcgcaccgtatttggcgat
catgaccgctttgtactgacctactttaaaacctttagaggaatgtacttcaccggtgat
ggtgcgaaacgcgacgaagatggttactactggatcactggacgcgttgatgatgtgata
aacgtatcaggtcatagattgggtacagcagaagttgaaagtgccttagttgcccatgag
caagttgcagaggccgcagttgttggctatccgcatgatattaaaggtcaggggatctat
gcttatgtgacgctgacgaggggtacggtagaaactgaagagctacgtcaagagcttcgc
caatgggttagaaaagagattggcgcactagcaactcctgatctcattcagtgggctggc
ggcttacctaagacacgttcaggaaagattatgcgtcgattcctacgtaagattgccgca
aatgaagtgacaaacctgggcgactcttcaacgcttgcagatcctgcagtcattgacaca
ctaattgagtctcgacttaaccgcagcgaataa

DBGET integrated database retrieval system