KEGG   Shewanella piezotolerans: swp_1918Help
Entry
swp_1918          CDS       T00791                                 

Definition
(GenBank) Tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
swp  Shewanella piezotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    swp_1918
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    swp_1918
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    swp_1918
Enzymes [BR:swp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     swp_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1968460..1969269)
Genome map
AA seq 269 aa AA seqDB search
MSNRYQAAFAALDKKNQGAFVPFVTLGDPSPELSLKIIDTLVENGADALELGFPFSDPLA
DGPVIQGANLRSLAAGTTPSQCFDMLSAVRAKYPDLPIGLLLYANLVYANGVDVFYAKAQ
AAGVDSVLIADVPVEEAEPFITSAKAHNVAPIFIAPPNADSETLQLVSDKGEGYTYLLSR
AGVTGTESKAGMPITDILNRLKEFNGAPPLLGFGIAEPKQVKAAIDAGAAGAISGSAVVK
IIDANKDNEAQLLAALAEFTRNMKAATAR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcgttatcaggcagcctttgccgcactagataagaaaaaccaaggtgcattt
gtcccctttgtcactttaggcgacccatcacctgaattgtctttaaagataatcgatacc
ttagtagagaatggcgctgatgcgctagagcttggcttcccattttctgatccactggcc
gatggcccggtgatccaaggtgctaacctgcgctcactcgccgcaggtacaaccccgtcg
caatgtttcgacatgctaagcgctgtgcgtgctaaatacccagacttaccaattggtttg
ctactgtatgccaacctggtttacgccaatggggttgacgttttttatgccaaagcgcaa
gccgcgggcgttgattccgtacttatcgccgatgtgccagtagaagaagccgagccattc
attacatcggcaaaagcgcataacgtcgcgccgatatttatcgcaccacccaatgctgac
agtgaaacactacaacttgtgagcgataaaggtgaaggatatacctatctgttatcgcgc
gcaggggtgactggtacagaatcaaaagccggtatgccaatcactgatattctaaaccgc
ctgaaagagtttaatggcgcaccgccgctactgggctttggtattgcagagcctaaacag
gtcaaagccgccattgatgcaggggcagctggcgctatttcaggctcagcggtcgttaaa
atcattgatgccaacaaagacaatgaagcgcagttgctagccgcacttgcagagtttact
cgcaatatgaaggcagcgacggcaaggtaa

DBGET integrated database retrieval system