KEGG   Shewanella piezotolerans: swp_1919Help
Entry
swp_1919          CDS       T00791                                 

Definition
(GenBank) Tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swp  Shewanella piezotolerans
Pathway
swp00260  Glycine, serine and threonine metabolism
swp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01130  Biosynthesis of antibiotics
swp01230  Biosynthesis of amino acids
Module
swp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    swp_1919
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    swp_1919
Enzymes [BR:swp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     swp_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACJ28677
UniProt: B8CLM6
Position
complement(1969262..1970479)
Genome map
AA seq 405 aa AA seqDB search
MSKLNPYFGEYGGMYVPQILMPALKQLETAFIEAQQDEAFQKEFTDLLKNYAGRPTALTL
TRNLSPNPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSATLKDACNEAMRDWSASY
DKAHYLLGTAAGPHPFPTIVREFQRMIGAETKQQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEEEVALIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYSVS
AGLDFPSVGPQHAHLAATGRATYESATDDEALETFQLLARSEGIIPALESAHALAYAVKL
AKAATKETLLVVNLSGRGDKDIFTVADILEKQQADSSTTEESGNE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttaaacccctactttggggaatacggcggcatgtacgtaccgcagatttta
atgccagcactaaaacagttagaaacagcctttatcgaagcgcaacaagatgaagcgttt
caaaaggagtttaccgacctgcttaaaaactacgcgggccgtccaacagcactcacactc
acacgtaacctcagccctaatccactggcaaaaatctacctcaaacgtgaagacttgctc
cacggtggcgctcacaaaaccaaccaagtgttaggccaagccttgctcgcaaaacgcatg
ggtaagaaagagatcatcgccgaaacgggtgctggccagcatggtgttgccaccgcactt
gcttgtgcgctgctcgacttgaaatgcaaagtgtatatgggcgccaaagatgttgagcgc
caatcacctaacgtatttagaatgaagctaatgggcgctgaagttattcctgtcacttca
ggttctgccaccctaaaagatgcctgtaacgaagcgatgcgtgactggtcagccagttac
gacaaagcgcactacctgttaggcaccgcagcggggccacaccccttcccgactattgta
cgtgagtttcagcgtatgattggcgccgaaaccaaacaacagatccttgagcgtgaaggt
cgcctacccgatgccgttatcgcttgtgtcggcggtggttcaaatgctatcggaatgttt
gcagacttcatcgatgaagaggaagtggcattaattggtgttgaacccgcgggtaaaggt
atcgataccccaatgcatggcgcgccgttaaagcatggcaaaaccggcatattctttggt
atgaaagcaccattgatgcaagacagcgaaggtcaaattgaagagtcttactctgtatca
gctggtctcgacttcccatcagttgggccgcagcatgcacaccttgccgcaacgggccgt
gcaacttacgagtcagcaactgatgatgaagcattagagacattccaactactcgcccgt
agtgaaggaattattcctgcgctagagtcagcgcatgcacttgcttatgccgtcaagctt
gccaaagcggcaaccaaagagaccttactagtcgtcaacttatctggtcgtggtgacaaa
gacattttcaccgtggctgacattttagaaaagcagcaagcagacagctcaacaactgag
gagagtggcaatgagtaa

DBGET integrated database retrieval system