KEGG   Shewanella piezotolerans: swp_1919Help
Entry
swp_1919          CDS       T00791                                 

Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swp  Shewanella piezotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    swp_1919
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    swp_1919
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    swp_1919
Enzymes [BR:swp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     swp_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1969262..1970479)
Genome map
AA seq 405 aa AA seqDB search
MSKLNPYFGEYGGMYVPQILMPALKQLETAFIEAQQDEAFQKEFTDLLKNYAGRPTALTL
TRNLSPNPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSATLKDACNEAMRDWSASY
DKAHYLLGTAAGPHPFPTIVREFQRMIGAETKQQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEEEVALIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYSVS
AGLDFPSVGPQHAHLAATGRATYESATDDEALETFQLLARSEGIIPALESAHALAYAVKL
AKAATKETLLVVNLSGRGDKDIFTVADILEKQQADSSTTEESGNE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttaaacccctactttggggaatacggcggcatgtacgtaccgcagatttta
atgccagcactaaaacagttagaaacagcctttatcgaagcgcaacaagatgaagcgttt
caaaaggagtttaccgacctgcttaaaaactacgcgggccgtccaacagcactcacactc
acacgtaacctcagccctaatccactggcaaaaatctacctcaaacgtgaagacttgctc
cacggtggcgctcacaaaaccaaccaagtgttaggccaagccttgctcgcaaaacgcatg
ggtaagaaagagatcatcgccgaaacgggtgctggccagcatggtgttgccaccgcactt
gcttgtgcgctgctcgacttgaaatgcaaagtgtatatgggcgccaaagatgttgagcgc
caatcacctaacgtatttagaatgaagctaatgggcgctgaagttattcctgtcacttca
ggttctgccaccctaaaagatgcctgtaacgaagcgatgcgtgactggtcagccagttac
gacaaagcgcactacctgttaggcaccgcagcggggccacaccccttcccgactattgta
cgtgagtttcagcgtatgattggcgccgaaaccaaacaacagatccttgagcgtgaaggt
cgcctacccgatgccgttatcgcttgtgtcggcggtggttcaaatgctatcggaatgttt
gcagacttcatcgatgaagaggaagtggcattaattggtgttgaacccgcgggtaaaggt
atcgataccccaatgcatggcgcgccgttaaagcatggcaaaaccggcatattctttggt
atgaaagcaccattgatgcaagacagcgaaggtcaaattgaagagtcttactctgtatca
gctggtctcgacttcccatcagttgggccgcagcatgcacaccttgccgcaacgggccgt
gcaacttacgagtcagcaactgatgatgaagcattagagacattccaactactcgcccgt
agtgaaggaattattcctgcgctagagtcagcgcatgcacttgcttatgccgtcaagctt
gccaaagcggcaaccaaagagaccttactagtcgtcaacttatctggtcgtggtgacaaa
gacattttcaccgtggctgacattttagaaaagcagcaagcagacagctcaacaactgag
gagagtggcaatgagtaa

DBGET integrated database retrieval system