KEGG   Shewanella piezotolerans WP3: swp_1940Help
Entry
swp_1940          CDS       T00791                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:swp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1992210..1992854)
Genome map
AA seq 214 aa AA seqDB search
MALFSDIKPFLDLKNRRLGFVLLFIFSSFPLSAAPILILGDSLSASYGMPENEGWVHLLR
KKMPDHTIINGSVSGETSAGGLRRLPALLDSASPEVLLIELGGNDGLRGFPPKQLKNNLT
KIIELAQDKQIKVLLSEIMVPPNYGPRYASQISSVYKELAAEHDITLMPFFMELIITDST
LMQRDGIHPNAKAQPQIAEFMQPWLQQATESDTK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttttttcagacataaaacccttcttagaccttaaaaaccgacgactcggtttt
gtcttattatttattttcagcagtttcccgctaagtgctgcccctatattaatcctaggt
gacagcctaagtgcaagttatggcatgccggaaaatgaaggttgggtgcatcttctccgc
aaaaaaatgcccgaccataccatcattaatggctctgttagtggcgaaacctcagcgggt
ggattacgcagactgcccgccctgcttgactcagcgagccctgaggtactgctaattgaa
cttggcggcaacgacggtcttcgtggttttccgcctaagcagctgaaaaataatcttaca
aaaatcatcgagcttgcccaagataaacagataaaagtgctactgagtgaaattatggta
ccgcctaactacggcccacgctatgcatctcagatatcaagcgtttataaagaactcgct
gccgagcatgatattaccttaatgccgttctttatggagttgattatcactgacagtacg
ttgatgcaaagagatgggatccatccaaatgcaaaggcccagccacaaatcgcagagttt
atgcagccatggttacaacaagcgacggaaagtgacactaaataa

DBGET integrated database retrieval system