KEGG   Shewanella piezotolerans: swp_2088Help
Entry
swp_2088          CDS       T00791                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     swp_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161615..2162709
Genome map
AA seq 364 aa AA seqDB search
MGLEAPNIDELRALYMQAPKCWPAPLLDVGIAKRELGLLPAPIFPADNPFSQLKLRLGDK
LFHDPQLSRSGHIACASCHDRNLGWADGRQVSFGHHRLKGKRNAPSIENSAFYSSLFWDG
RAASLEEQALMPITDSVEMNFTLDELEERLSNDPQYVQLFKLTFGSEEVTRERIAQAIAT
FERTILSRRSRFDIFLMASEIEEESQKQRLSAAFSDESVRGLHLFRTKARCMNCHNGPEM
SDSQFHNIGLTYYKRFYQDLGLYNHTRNYDDVGKFRTPGLRGVMNTKPWMHNGLFVNMEG
LLNFYNMGGVASQKTREDPLAPQTSIHLKPLKLTQSEIKDLMAFLESISGHPARGPHMRY
MPEP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaggcgcctaatattgacgagttaagggccttgtatatgcaagcgcctaag
tgctggcctgcacccttactagatgtaggcattgcaaaaagagagttaggtttgttgccg
gctcccattttccctgcagacaatccatttagccaacttaagctgcgtttaggtgacaag
ctatttcatgatccccagctttcgcggtcaggccatatcgcttgcgcctcttgccatgat
aggaatttaggttgggctgatggtaggcaagtgtcttttggtcatcatagattaaaaggc
aaacgtaatgcccccagtattgagaatagcgctttttacagcagccttttttgggatggt
agggcggcaagtttagaagaacaagcgctgatgccgattaccgatagtgttgaaatgaac
tttactcttgatgagctagaggaaaggctcagtaatgatccgcagtatgtgcagctcttt
aaattaactttcggcagtgaagaggtgactcgagaacgaattgcacaagccattgccact
tttgagcgaaccatcctatcgcgccgaagtcgatttgatattttcctgatggcaagtgaa
attgaggaagaaagccaaaagcaaaggttaagtgccgctttttctgatgaatcagtcaga
ggtctacacctatttagaactaaagccagatgtatgaactgtcataatggtcctgaaatg
agtgatagccaatttcataacatcgggctgacctactataaaagattttatcaagatcta
ggtttgtataatcatacgcgtaactatgatgatgtgggcaagttcagaacgcctgggctg
agaggagttatgaataccaaaccttggatgcataatggcttattcgtcaacatggaaggc
ttgttgaatttttataatatgggcggtgtagcgagccaaaaaacacgtgaggatccgcta
gcaccacaaacttcaatccacttaaagccgcttaaattgactcaaagtgagatcaaagat
ctgatggcatttctagaatcgatatcgggtcaccctgcaagagggccacatatgcgttac
atgccagagccataa

DBGET integrated database retrieval system