KEGG   Shewanella piezotolerans: swp_2219Help
Entry
swp_2219          CDS       T00791                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
swp  Shewanella piezotolerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    swp_2219
Enzymes [BR:swp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     swp_2219
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   swp_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2310718..2312199
Genome map
AA seq 493 aa AA seqDB search
MSKKYVIALDQGTTSSRAIVFDHDANMVASSQREFGQIYPQPGWVEHDAMEIWASQSSTL
IEALARADIHSEDVAAIGITNQRETTVIWDKMTGKPVYNAIVWQCRRSKAICDELKAQGL
EEYVKDCTGLLLDPYFSGTKIKWILDNVEGVRERAEKGELLFGTIDTWLVWKLTEGKVHV
TDPTNASRTLLFNIHQQAWDEKLLNALGIPRSLLPEVKPSSAIYGQTRIAGEGSSIAIAG
IAGDQQSALFGQLCIDEGMAKNTYGTGCFLLMNTGTEAVKSQQGLLTTIAVGAKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDAQDTEYFASKVENTNGVYLVPAFVGLGAPYWDPDAR
GALVGLTRGANRNHIIRAALEAIAYQSRDLLDAMSKDSGVELKQIKVDGGAVANDFLMQF
QADITNVDVLRPELTETTAMGAAFLAGLAVGFWSSTAELKHKAGIERRFKPKINDAQRAT
LYDGWKEAVARTR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagaaatatgtcatcgcattggatcaaggtaccacgagttcaagagcaattgtt
ttcgatcacgatgcgaatatggtggcgagctcacaacgagaatttggccagatttaccca
caaccaggttgggtagagcatgatgcaatggagatctgggcatcgcaaagctcaacctta
attgaagcgttagcacgagcggatattcatagtgaagatgtcgccgcgatagggatcacc
aatcagcgtgaaaccacggttatttgggataaaatgactggcaaacccgtgtataacgcc
attgtatggcagtgccgaagaagcaaagcgatttgtgatgaattgaaggctcaaggttta
gaagagtacgttaaagattgcacggggttactgctcgatccctatttttctggcaccaaa
attaagtggatcctagataatgttgagggagtaagggagcgtgcagaaaagggcgaatta
ttatttggtaccattgatacttggttagtgtggaagcttaccgaaggtaaagtacacgtc
accgatccaaccaatgcctcccgaacgctattgttcaatattcatcagcaagcttgggat
gaaaagctacttaacgcgttaggtataccgcgctctcttctgccagaggttaaaccttca
tctgctatctatggtcaaactcgcatagcaggtgaaggcagtagcattgctatcgcaggt
attgcgggcgatcaacaatcagcgttattcggtcaactttgtattgacgagggcatggct
aaaaatacctatggtacaggctgttttttactgatgaacactggtactgaggcggtaaaa
tcccaacaaggcttgttaacgacaattgcagtgggcgctaaaggtgaggttaattatgca
ctcgaaggctcagtatttatgggcggagcaacgattcaatggctgcgcgatgagttaggg
ttgattagggatgcacaagacactgaatactttgcttcgaaggtagaaaataccaatggc
gtatatttggtacctgcttttgttggtttaggcgcgccgtattgggatcccgatgccaga
ggcgctttagttggcttaacccgtggtgcaaatcgaaatcatattattcgtgcagctctg
gaagctattgcttatcaaagtcgagatctacttgatgctatgagtaaagacagcggcgtg
gagctgaagcagatcaaggttgatggtggtgcggtcgctaatgacttcctaatgcagttt
caagcagatatcactaatgtagatgtattgcgccccgagttaaccgaaaccacggcaatg
ggtgcagcctttttagctggattagctgttggtttttggagttcgactgctgaacttaaa
cacaaagcgggtattgaacgacgctttaaacctaagattaacgatgctcagagagcaaca
ctttatgacggctggaaagaggctgtggccagaactcgctaa

DBGET integrated database retrieval system