KEGG   Shewanella piezotolerans WP3: swp_2399Help
Entry
swp_2399          CDS       T00791                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
swp  Shewanella piezotolerans WP3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2510708..2511751
Genome map
AA seq 347 aa AA seqDB search
MDMAQHLSETELSARILRHAVPKMSELNIPVTPNNYSVWYEYYLGINLDLKRAIDGLLAN
EVSFTATVCEGLFTTYIQQHSPEVVENVQIETQLLINQLLAKIAGMSHGNVKFSSSLKAF
DKALKTNPSSEVLQQLVDDITTELDGIIDANIAMDQSLNTINQEVSALKSEMSELRSVVM
TDQLTSLNNRRAFDEEVISHIDTFNQKEFESSLLVVDIDHFKKFNDVHGHLIGDKVLTYV
AQALKQSVKGDDFVARYGGEEFVILLPNTGIDEAKIVANNLRQKIAKRNLTIGKEKKLPL
GNITVSVGCASLKNEDSKDSYFIRADEALYRAKSAGRNCVMVESESN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatatggctcaacatttgtctgagaccgagttgtcagcgcgaattttaaggcatgca
gttcccaagatgtcagaactgaacattcctgttacaccgaataactattccgtttggtat
gagtattacttaggcattaatttagatttaaaacgggcgattgacggattactagcaaac
gaagtcagttttacggcgacggtatgtgaaggtttgtttaccacgtatatacagcaacat
tcacccgaagtcgtggagaatgtgcagatagaaacgcaattattaattaatcagttgctt
gctaaaattgctggaatgagccacggaaatgtaaagttttcatcgtcgttaaaggcgttc
gataaagcacttaaaactaacccaagctctgaagtcttacagcaacttgtcgatgatatt
accaccgaattagatggtattattgatgctaatattgccatggatcaaagccttaatacc
attaatcaagaggtttctgcacttaaatctgagatgtctgaacttcgctctgttgtcatg
accgatcagctaacttcacttaataatcgccgtgcttttgacgaagaagtgataagtcat
attgacaccttcaaccagaaagagtttgaaagtagtttactggtggttgatattgatcat
ttcaaaaagttcaacgatgtacatggacatttaatcggtgacaaggtactaacatacgta
gctcaggcactgaaacagagtgttaaaggcgatgattttgttgctcggtacggcggtgag
gagtttgtcattctgttgcctaatacgggaatcgatgaagctaaaattgttgctaataat
ttgcgacaaaaaatagcaaaacggaacctgaccataggcaaagagaagaaacttcctttg
ggcaatattacggtttcagttggctgtgcatcattgaaaaatgaagatagcaaagatagc
tactttattcgtgctgatgaggcgctgtatcgtgctaaatcggccgggcgtaattgtgtg
atggtcgaatcggaatcgaattaa

DBGET integrated database retrieval system