KEGG   Shewanella piezotolerans: swp_2399Help
Entry
swp_2399          CDS       T00791                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     swp_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2510708..2511751
Genome map
AA seq 347 aa AA seqDB search
MDMAQHLSETELSARILRHAVPKMSELNIPVTPNNYSVWYEYYLGINLDLKRAIDGLLAN
EVSFTATVCEGLFTTYIQQHSPEVVENVQIETQLLINQLLAKIAGMSHGNVKFSSSLKAF
DKALKTNPSSEVLQQLVDDITTELDGIIDANIAMDQSLNTINQEVSALKSEMSELRSVVM
TDQLTSLNNRRAFDEEVISHIDTFNQKEFESSLLVVDIDHFKKFNDVHGHLIGDKVLTYV
AQALKQSVKGDDFVARYGGEEFVILLPNTGIDEAKIVANNLRQKIAKRNLTIGKEKKLPL
GNITVSVGCASLKNEDSKDSYFIRADEALYRAKSAGRNCVMVESESN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatatggctcaacatttgtctgagaccgagttgtcagcgcgaattttaaggcatgca
gttcccaagatgtcagaactgaacattcctgttacaccgaataactattccgtttggtat
gagtattacttaggcattaatttagatttaaaacgggcgattgacggattactagcaaac
gaagtcagttttacggcgacggtatgtgaaggtttgtttaccacgtatatacagcaacat
tcacccgaagtcgtggagaatgtgcagatagaaacgcaattattaattaatcagttgctt
gctaaaattgctggaatgagccacggaaatgtaaagttttcatcgtcgttaaaggcgttc
gataaagcacttaaaactaacccaagctctgaagtcttacagcaacttgtcgatgatatt
accaccgaattagatggtattattgatgctaatattgccatggatcaaagccttaatacc
attaatcaagaggtttctgcacttaaatctgagatgtctgaacttcgctctgttgtcatg
accgatcagctaacttcacttaataatcgccgtgcttttgacgaagaagtgataagtcat
attgacaccttcaaccagaaagagtttgaaagtagtttactggtggttgatattgatcat
ttcaaaaagttcaacgatgtacatggacatttaatcggtgacaaggtactaacatacgta
gctcaggcactgaaacagagtgttaaaggcgatgattttgttgctcggtacggcggtgag
gagtttgtcattctgttgcctaatacgggaatcgatgaagctaaaattgttgctaataat
ttgcgacaaaaaatagcaaaacggaacctgaccataggcaaagagaagaaacttcctttg
ggcaatattacggtttcagttggctgtgcatcattgaaaaatgaagatagcaaagatagc
tactttattcgtgctgatgaggcgctgtatcgtgctaaatcggccgggcgtaattgtgtg
atggtcgaatcggaatcgaattaa

DBGET integrated database retrieval system