KEGG   Shewanella piezotolerans: swp_2623Help
Entry
swp_2623          CDS       T00791                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
swp  Shewanella piezotolerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    swp_2623
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_2623
   00620 Pyruvate metabolism
    swp_2623
   00650 Butanoate metabolism
    swp_2623
  Lipid metabolism
   00071 Fatty acid degradation
    swp_2623
  Amino acid metabolism
   00350 Tyrosine metabolism
    swp_2623
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    swp_2623
   00626 Naphthalene degradation
    swp_2623
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     swp_2623
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     swp_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2750662..2753277
Genome map
AA seq 871 aa AA seqDB search
MTVTNEQELNNLVSRVVEAQRQFADYNQEQVDVIFRAAALAAADARISLAKMAASETRMG
VLEDKVIKNHFASEYIYNKYKDEKTCGILSEDPTFGTITIAEPVGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNSTTTAAKIVLEAAVAAGAPKDIIGWIDEPSVALSNQ
LMTHADINLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVVIVDEIYDVVKERFASHGGYVLNAVETTAMQDVILKNGGLNADIVGQS
AANIAKMAGIDVHHSTKVLIGEVSNIDQAEAFAHEKLSPLLAMYRANDFEDAMDKAEALV
TLGGIGHTSGLYTDQDTQVERVKTFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKMVAKRAENMLWHKLPSSIYFRRGSLPIALEELSEKKRA
LIVTDKYLFNNGYCDETIKILKSQGLETEVFYDVEADPTMQIVEQGAKVAHSFQPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKLGKKAKMVAIPTTSGTG
SEVTPFAVVTDEKTGMKYPIADYELTPNMAIVDPNLVMDMPKSLTAFGGIDAITHALEAY
VSVMANEYSDGQALQALDLLFTHLPDSYEHGANAPLAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDMPTKQAAFSQYDRPKALCRYAKIAEYL
KLEGTIGEGITDEEKVEALLKEIDVIKEKIGIPSSIQAAGVNEADFIAKLDELAEDAFDD
QCTGANPRYPLIAELKQVLLASYYGNDYSDE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgacagttactaacgaacaggaactcaataatctggtaagcagagtcgttgaagctcaa
cgacaatttgccgattataaccaagaacaagttgatgtgatctttagagcagcagcgctt
gctgcagcagatgctcggatctcgctagcaaaaatggcggcttcagaaactagaatgggc
gtactcgaagataaagtcattaaaaaccacttcgcctctgagtatatctacaacaaatac
aaggatgagaaaacctgtgggatcttatctgaagaccctacctttggtaccatcacgatt
gcagaaccggttggattaatctgcggtatcgtgcccaccacgaatccaacatctactgcg
atatttaaagcattaatcagcctaaaaacgcgtaatggtattattttttctcctcatcca
agagctaaaaactcaaccacaacagctgccaaaatagtgttagaagccgctgtagctgct
ggtgcgcccaaagacattataggctggatagatgagccttcagtcgccctttcaaatcaa
ttaatgacccatgccgatattaaccttatattagctactggcggcccaggtatggtcaaa
gctgcttactcttcagggaaaccagctattggtgttggtgccggaaacacgccgattgtt
atcgatgaaacggctgatataaaacgcgctgtcagttctatattgatgtcaaaaaccttt
gataatggtgtggtctgtgcttcagagcaagccgttgtcattgttgatgagatctatgat
gtcgtcaaagaacgttttgccagccatggaggttatgtacttaatgctgttgaaactaca
gctatgcaagatgttatccttaaaaatggtggtttgaacgccgatattgtaggacaaagt
gccgctaacatcgcaaaaatggcgggcatagacgttcatcacagtactaaggtgctaatt
ggtgaagtcagcaatatcgaccaagcagaagcctttgctcatgaaaaattatcgcctctt
ttagccatgtatcgtgcaaatgattttgaagatgcgatggataaagccgaagcgttagtc
actcttggcggtattggtcatacatctggcttgtacaccgatcaagatactcaagttgag
cgcgtaaaaacatttggctttagaatgaaaactgcacgcattctaattaatactccagca
tcacaaggcggcatcggcgatctttacaatttcaaactcgctccctctttaacgctaggt
tgcggttcttggggtggaaactcaatttcagaaaatgtaggtccaagtcatctaattaac
aaaaaaatggtcgctaaaagggctgagaatatgttgtggcacaaacttccatcatctatt
tacttccgccgtggtagtttgcccattgctttagaggaactttcagagaagaagcgtgcg
cttatcgtcactgataagtatctattcaacaatggatactgtgatgaaactataaaaatc
ctcaaaagccaagggttagaaactgaagtcttctacgatgtcgaagctgatccaacgatg
caaatcgttgagcaaggcgctaaagttgcgcacagtttccaaccagacgtcatcatcgct
ctgggtggtggttcaccaatggatgcagcaaaaattatatgggtgatgtacgaacatcca
gacgtcgactttgccgatcttgcattacgctttatggatatccgtaaacgtatctacaaa
ttccctaaattgggtaaaaaagccaagatggttgcgatacccacaacgtcaggaacggga
tcagaagtgactccttttgctgtggtcacagacgaaaaaacggggatgaagtaccctatt
gccgattatgaactcacgcctaacatggcaattgttgatcctaatttagtgatggatatg
ccgaaatccctaacggcttttggcggtattgatgcaattactcacgcacttgaagcctat
gtaagtgtaatggcaaacgaatacagtgacggccaagctctgcaagcgctagacctgcta
ttcactcatctaccggattcttatgagcatggagccaatgccccattagcccgagagaaa
gtacataacggcgcaactattgcgggtatcgcatttgccaacgcattcctcggtatctgt
cactctatggcgcataagctcggcgctgagttccacttagcacacggtcttgcaaacgcg
ctgcttattagtaatgttattcgattcaacgcgacagacatgccgaccaagcaagcagca
tttagtcaatacgatagaccaaaagcattatgtcgctatgcaaaaatagctgagtactta
aaacttgaaggcaccatcggtgaaggcattacagatgaagaaaaagtcgaggctctactt
aaagaaattgatgtcatcaaggagaagattggcattccaagctcaatccaagctgcaggc
gtcaacgaagccgacttcatcgcaaaactagatgaactcgctgaagatgcatttgatgat
cagtgcactggggctaaccctcgttacccacttattgcagaactgaagcaggttttacta
gcaagctactacggtaatgattacagcgatgaataa

DBGET integrated database retrieval system