KEGG   Shewanella piezotolerans WP3: swp_2624Help
Entry
swp_2624          CDS       T00791                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:swp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:swp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:swp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753411..2755588)
Genome map
AA seq 725 aa AA seqDB search
MTQYIQIGGLKVATELAELVKAEICQDIGISAETVWTKFEELIAEFAPINRRLLEKREQL
QHQLDEWHVGHKGQDFNLESYKSFLTDIGYLVPEGETFSISTENVDTEITDQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISESNGAELTKTYNPQRGAKVIAFAKQHLDTAA
PLIQASHADVTKYWIEGDQLKVSLENGVETQLANPERFAGYKGAAKSPEAILLKNNGLHI
EIQIDAVSLIGQSDKAGVSDLLVEAAVTTIMDCEDSVAAVDAEDKVEIYRNWLGLMQGNL
TATLAKNGKDIVRELNDDRSYTAANGQQLVLPGRSLLFVRNVGHLMTINAVLDQHGEEVP
EGILDGMFTVLAALHDIKGHNNNRSNSRKGSINIVKPKMHGPEEVKFTCELFTKIEDALK
LARNTIKVGIMDEERRTTVNLKECIREASERVVFINTGFLDRTGDEIHTSMQAGPFVAKS
KMKQQKWIAAYEDWNVDIGLECGLQGRSQIGKGMWPMPDEMAAMLEQKIGHPLAGANTAW
VPSPNGAVLHSTHYHKINVKDVQNELQNRDRASLDDLLTIPLMAEPSELSSELKAFELEN
NAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHLANWLTHGICTEEEVMT
ALKKMAAIVDEQNKGDSRYINMSPSFDGIAFKAACDLVFKGTTQPSGYTEPLLHAYRIKA
KALAL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatatattcaaattggcggtttaaaggttgctacagaattagctgagctggtc
aaagctgagatttgtcaagatattgggatctcggcagaaactgtatggacaaagtttgaa
gaacttatagctgaatttgcacctattaaccgtcgcttattggaaaagagagagcagctt
caacatcaacttgatgaatggcatgttggccataaggggcaagactttaacttagagtcg
tacaaaagtttcttaactgatatcggttatttagtgccggaaggggaaacattctcaatc
agtactgaaaatgtagatacagaaatcactgaccaggcaggtccacaacttgtggtgccg
gttaaaaatgcccgttttgctctaaacgctgctaatgcacgttggggtagcctatacgat
gcattatacggtactgatgcgatatcagagtcaaatggtgccgaactaaccaaaacctat
aaccctcaacgcggcgctaaagtgatcgcttttgcaaagcagcaccttgatacggcagca
ccactaattcaagcctctcatgccgatgtaaccaaatattggattgaaggtgatcaatta
aaggtatcccttgagaatggagtagaaacacaacttgctaaccccgagcgctttgcgggt
tataagggagcggccaaatcacctgaagcaattttacttaagaacaatggcctacatata
gagatccaaatagatgcagtgagtctaattggccaaagtgataaggcgggggtcagtgat
cttttagttgaggcagctgtgactaccattatggattgtgaagactctgtggctgcggtt
gatgctgaagataaagtcgagatctaccgtaattggcttggtttaatgcaaggcaatttg
actgcaacgcttgctaaaaacggcaaagatattgttcgagagcttaatgatgacagaagc
tataccgcagcaaatggacagcaattagtattacctggtcgtagtttattgtttgtccgt
aacgttggtcacttaatgacaatcaatgcagtattagatcagcatggtgaagaggttcct
gaggggatcttagatggcatgtttaccgtactagcagcgctacatgatataaaaggtcat
aataacaatcgcagtaacagccgcaagggctcaattaacatagtaaagcctaagatgcat
gggcctgaagaggtaaagtttacttgtgagttgttcactaaaattgaagatgcgttaaag
ctggcccgtaacacaattaaagtcggcattatggatgaagagcgccgcacaacggtcaat
ctgaaagagtgtattcgtgaagcctctgaaagagtggtatttattaatactggattttta
gataggactggcgacgagatccacacgtcaatgcaagcaggtccatttgttgcgaaatct
aaaatgaaacagcaaaagtggattgcagcctatgaagattggaatgttgatattggcttg
gagtgtggcctgcagggacgttcgcaaattggtaaaggcatgtggccaatgcctgatgaa
atggctgcaatgcttgagcaaaagattggtcatccgttggctggtgcgaatactgcttgg
gttccgtctcccaatggtgcggttttacattctactcactatcacaaaattaatgtaaag
gatgtgcagaatgaattgcaaaatcgtgacagagcaagtttagatgacctacttaccatc
ccacttatggcagagccatctgagctatcctcagagttaaaggcttttgagttggaaaac
aatgcacaaggaatattgggctatgtcgtccgttggattgaccaaggcgtaggttgttcc
aaggtacctgatattaataatgtgggattgatggaagatagggcaacattaaggatctct
tctcagcatttagcgaattggttaacacacggcatatgcaccgaagaagaagtcatgacc
gcgcttaaaaagatggctgcaattgttgatgagcaaaacaaaggtgatagtcgctacatt
aatatgtctcctagtttcgatggcatcgcatttaaagcggcttgcgatctagtatttaaa
ggaaccactcagccttctggttacaccgagcctttattacatgcttatcgcataaaggct
aaagctttagcactttag

DBGET integrated database retrieval system