KEGG   Shewanella piezotolerans: swp_2624Help
Entry
swp_2624          CDS       T00791                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
swp  Shewanella piezotolerans
Pathway
swp00620  Pyruvate metabolism
swp00630  Glyoxylate and dicarboxylate metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01200  Carbon metabolism
Module
swp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    swp_2624
   00630 Glyoxylate and dicarboxylate metabolism
    swp_2624
Enzymes [BR:swp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     swp_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Nitr_red_bet_C
Motif
Other DBs
NCBI-ProteinID: ACJ29360
UniProt: B8CPB6
Position
complement(2753411..2755588)
Genome map
AA seq 725 aa AA seqDB search
MTQYIQIGGLKVATELAELVKAEICQDIGISAETVWTKFEELIAEFAPINRRLLEKREQL
QHQLDEWHVGHKGQDFNLESYKSFLTDIGYLVPEGETFSISTENVDTEITDQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISESNGAELTKTYNPQRGAKVIAFAKQHLDTAA
PLIQASHADVTKYWIEGDQLKVSLENGVETQLANPERFAGYKGAAKSPEAILLKNNGLHI
EIQIDAVSLIGQSDKAGVSDLLVEAAVTTIMDCEDSVAAVDAEDKVEIYRNWLGLMQGNL
TATLAKNGKDIVRELNDDRSYTAANGQQLVLPGRSLLFVRNVGHLMTINAVLDQHGEEVP
EGILDGMFTVLAALHDIKGHNNNRSNSRKGSINIVKPKMHGPEEVKFTCELFTKIEDALK
LARNTIKVGIMDEERRTTVNLKECIREASERVVFINTGFLDRTGDEIHTSMQAGPFVAKS
KMKQQKWIAAYEDWNVDIGLECGLQGRSQIGKGMWPMPDEMAAMLEQKIGHPLAGANTAW
VPSPNGAVLHSTHYHKINVKDVQNELQNRDRASLDDLLTIPLMAEPSELSSELKAFELEN
NAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHLANWLTHGICTEEEVMT
ALKKMAAIVDEQNKGDSRYINMSPSFDGIAFKAACDLVFKGTTQPSGYTEPLLHAYRIKA
KALAL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatatattcaaattggcggtttaaaggttgctacagaattagctgagctggtc
aaagctgagatttgtcaagatattgggatctcggcagaaactgtatggacaaagtttgaa
gaacttatagctgaatttgcacctattaaccgtcgcttattggaaaagagagagcagctt
caacatcaacttgatgaatggcatgttggccataaggggcaagactttaacttagagtcg
tacaaaagtttcttaactgatatcggttatttagtgccggaaggggaaacattctcaatc
agtactgaaaatgtagatacagaaatcactgaccaggcaggtccacaacttgtggtgccg
gttaaaaatgcccgttttgctctaaacgctgctaatgcacgttggggtagcctatacgat
gcattatacggtactgatgcgatatcagagtcaaatggtgccgaactaaccaaaacctat
aaccctcaacgcggcgctaaagtgatcgcttttgcaaagcagcaccttgatacggcagca
ccactaattcaagcctctcatgccgatgtaaccaaatattggattgaaggtgatcaatta
aaggtatcccttgagaatggagtagaaacacaacttgctaaccccgagcgctttgcgggt
tataagggagcggccaaatcacctgaagcaattttacttaagaacaatggcctacatata
gagatccaaatagatgcagtgagtctaattggccaaagtgataaggcgggggtcagtgat
cttttagttgaggcagctgtgactaccattatggattgtgaagactctgtggctgcggtt
gatgctgaagataaagtcgagatctaccgtaattggcttggtttaatgcaaggcaatttg
actgcaacgcttgctaaaaacggcaaagatattgttcgagagcttaatgatgacagaagc
tataccgcagcaaatggacagcaattagtattacctggtcgtagtttattgtttgtccgt
aacgttggtcacttaatgacaatcaatgcagtattagatcagcatggtgaagaggttcct
gaggggatcttagatggcatgtttaccgtactagcagcgctacatgatataaaaggtcat
aataacaatcgcagtaacagccgcaagggctcaattaacatagtaaagcctaagatgcat
gggcctgaagaggtaaagtttacttgtgagttgttcactaaaattgaagatgcgttaaag
ctggcccgtaacacaattaaagtcggcattatggatgaagagcgccgcacaacggtcaat
ctgaaagagtgtattcgtgaagcctctgaaagagtggtatttattaatactggattttta
gataggactggcgacgagatccacacgtcaatgcaagcaggtccatttgttgcgaaatct
aaaatgaaacagcaaaagtggattgcagcctatgaagattggaatgttgatattggcttg
gagtgtggcctgcagggacgttcgcaaattggtaaaggcatgtggccaatgcctgatgaa
atggctgcaatgcttgagcaaaagattggtcatccgttggctggtgcgaatactgcttgg
gttccgtctcccaatggtgcggttttacattctactcactatcacaaaattaatgtaaag
gatgtgcagaatgaattgcaaaatcgtgacagagcaagtttagatgacctacttaccatc
ccacttatggcagagccatctgagctatcctcagagttaaaggcttttgagttggaaaac
aatgcacaaggaatattgggctatgtcgtccgttggattgaccaaggcgtaggttgttcc
aaggtacctgatattaataatgtgggattgatggaagatagggcaacattaaggatctct
tctcagcatttagcgaattggttaacacacggcatatgcaccgaagaagaagtcatgacc
gcgcttaaaaagatggctgcaattgttgatgagcaaaacaaaggtgatagtcgctacatt
aatatgtctcctagtttcgatggcatcgcatttaaagcggcttgcgatctagtatttaaa
ggaaccactcagccttctggttacaccgagcctttattacatgcttatcgcataaaggct
aaagctttagcactttag

DBGET integrated database retrieval system