KEGG   Shewanella piezotolerans: swp_2629Help
Entry
swp_2629          CDS       T00791                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
swp  Shewanella piezotolerans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    swp_2629
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    swp_2629
Enzymes [BR:swp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     swp_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2757101..2758435
Genome map
AA seq 444 aa AA seqDB search
MISIKKHLLTTKRRYLYLSGWMVAALRSEFGPLPDQSMHEKTSVASLIKELYTFLRQADA
RELGGLFRQLDGASDADKPAIQAKIDNFETHVVPIIADIDAGFGNEEATYLMAKQMIEAG
ACCIQLENQVSDVKQCGHQDGKVTVPHVEFLAKINAVRYAFLELGIDDGVIVARTDSLGA
GLTQKIAVTNEAGDLGEQYNSFLEVEAIDAANLANGDVVFQQNGQLVKPSRLPNGLFKFR
AGTGEERCVLDCITSLQNGADLLWIETEKPHVSQIGGMVNEIRKTIPNAKLVYNNSPSFN
WTLNFRQQVFDAMKEAGQDVSAYNRDQLMSVDYDSTELAIQADEKIRTFQADAAREAGIF
HHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVANVQRKEIRQGIACVKHQNMAGSDMGD
DHKEYFSGDQALKASGKDNTMNQF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgattaaaaagcatctgcttaccactaaacgtcgatacctatatctttcaggc
tggatggttgcagcactgcgcagtgagtttggtccccttcccgaccaatctatgcacgag
aagacttctgtggcctctctgattaaagagttatacactttccttcgtcaagcagacgct
cgtgaacttggcggcttatttcgccaactcgacggagcaagcgatgcagacaaaccagct
attcaagcaaaaatagataacttcgagactcacgtagtaccaatcattgcagatattgat
gcaggttttggtaacgaagaagcgacgtacctaatggcgaagcagatgattgaagctggt
gcttgctgtattcagcttgaaaaccaagtatctgatgttaagcaatgtggacaccaggac
ggtaaagtgaccgtaccacacgtggagttcctagctaagattaacgcagtccgttatgcg
tttttagaacttggaattgatgacggcgtaatcgttgcgcgtaccgattcattaggcgct
ggactaacacaaaaaattgcagtcaccaatgaagcaggtgatttaggcgagcagtacaac
tctttcctagaagttgaagcaattgatgcggctaatcttgctaacggtgatgtggtgttc
cagcaaaatggtcagttagtgaaaccttcacgcttgccaaacggtctgtttaaattccgc
gctggtacaggtgaagaacgttgtgtactcgattgcattacttcactgcaaaatggtgct
gacttactgtggattgagactgaaaaaccacatgtttctcagattggtggcatggtcaat
gaaatccgtaaaacgatcccaaatgctaaattagtttataacaactcaccttcatttaac
tggacactcaacttccgtcaacaggtgtttgatgcaatgaaagaagcgggacaagatgtt
tctgcttacaaccgtgaccagctaatgagtgttgactacgattcgactgaacttgccatt
caagcagatgaaaaaattagaaccttccaagcagatgctgcacgtgaagcaggtattttc
catcatcttattacactaccgacctatcacactgcagctctttctactgataacttggct
aaagagtacttcggtgaccaaggtatgctgggctacgtggcgaatgttcaacgtaaggag
atccgtcaaggcatcgcctgtgttaaacaccagaatatggccggttcagatatgggtgat
gatcacaaagagtacttctctggtgatcaagcactaaaggcgtctggtaaagacaacacc
atgaaccaattttag

DBGET integrated database retrieval system