KEGG   Shewanella piezotolerans WP3: swp_2682Help
Entry
swp_2682          CDS       T00791                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:swp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2817326..2819851
Genome map
AA seq 841 aa AA seqDB search
MVGPNAFKQTVLTAAVSMALLITGCNNQHTVKSTTKSDTTPLSSDKQQNTIAPGIPGNSP
TWAFAGKTGIGTSYEPYIDGSYQDSAKNPISRVWFSLAQGIVTETMFGLIHNAQLKEMQF
VISGKDFVDTEKDDTEHSVEYLHTDEDGKPLSLAYKLINKDRDGKYQIEKHIFTDPDRDS
LMMKVVFTAFESGITPYLVVNPHIDNSGANDIAQYDDANKVFTVNTTDKNSSVMSVKSSV
DFSQASVGFVGISDGLTDLNNNGDMNWQYSATSDENQGGNVALTAQYPSPIIAAGAQQAK
ISFDLVIGFGNNKQTSLANTDATLAAGSDQVLADFNGEGDALGWEDYLSSLQALNNMVNT
TTDNGKLLYASALVLKAQEDKTHAGALIASLSNPWGDTVSAKVGSTGYKAVWPRDFYQCA
MAFLAMGDSQTPKTAFEYLEKVQVNENTPGYSGTPGWFLQKTHVDGQIEWVGVQLDQTAM
PIMLGWKLWQAGVLSDTEINHWYKKMLKPAAEFLVNGGEVNLDWNHTNITPLKTQQERWE
EQQGYSPSTTAAVISGLISASDIATHAGDKEAAKRYLATAKNMQGKINGLMVTTAGLLSA
PSGVERDNTQTQASLPYFVRLAPNGEPNKDNKLGDNNGRAGLDQRLILDGGFLELVRYGV
TSANDKTINNTVSLIDNQQLEDNLRVKYQFNAKDGSAIPGFRRYGNDGYGEDEVNGNSYA
ERGVNTAGQRGRVWPFFTGERGHFELAKLIQNNSLSNKEHQALINTYVQGMETFANEGLM
LPEQVWDGVGNPTRYNYKLGQGTNSATPLAWTHAEYIKLVRSMSDKKVWDNYSIVSDKLK
H
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggtaggtccaaacgcatttaaacaaacagtacttactgcagccgtgagtatggcattg
ttaattactggttgtaataatcaacatacagtaaaaagtacgactaaaagtgatacaaca
ccactgagtagtgataagcagcaaaacactatcgctcccggaataccaggcaactctcca
acttgggcttttgcaggaaaaaccggcataggtacctcttatgagccctatatagatggc
agttatcaggatagcgctaaaaatcctatcagccgagtttggttctcgcttgcccaaggt
attgtgactgaaaccatgtttggtcttatccacaacgcgcaattaaaagagatgcaattt
gtaatcagcggtaaagattttgtggatacagaaaaagacgatactgaacactctgtcgaa
tatttacacactgatgaggatggtaagccactatcactcgcctataagcttattaataaa
gatagagacggcaaataccaaatagaaaagcacatttttactgatcctgatcgcgattca
ctaatgatgaaggtggtctttactgcatttgaatcagggatcaccccttacctagtcgtt
aacccgcatatagacaatagcggggcaaatgatattgctcagtatgacgatgctaataaa
gtatttaccgttaatactaccgataaaaacagcagtgtcatgagtgtaaaatcgagtgtt
gactttagccaagcaagcgttggctttgtcggcatctcagatggattaaccgatctaaat
aataacggtgatatgaactggcagtacagcgcaacctctgatgaaaaccaaggagggaat
gtcgcactcacagcccagtacccgagcccaataatagctgcaggcgcgcagcaagctaag
atcagttttgatctcgtcatcggttttggcaacaacaagcaaaccagtttagcgaataca
gacgcgactctcgctgctggtagtgaccaagtacttgccgactttaatggtgaaggcgac
gccttagggtgggaagattatctaagctcactccaagctttaaacaacatggttaatacc
accacagacaatggcaagttgttatacgccagtgcattagtgttaaaggcacaagaagat
aaaacccatgcaggtgccttaatcgcttcactttctaacccatggggcgatacggtttct
gcaaaagttggcagcacgggctacaaggctgtatggccacgcgacttttatcagtgcgcg
atggcatttctagcaatgggcgacagccaaacgccaaaaacagcctttgaatatttggaa
aaagttcaggtgaatgaaaatactccgggttatagcggcactccgggatggtttttacaa
aaaacccatgtagatggacagattgaatgggtcggcgtgcagttagatcaaacagcgatg
cccatcatgctcggctggaagttatggcaagcaggtgtattaagcgatacagaaataaac
cattggtacaaaaagatgctcaaacctgccgcagagtttcttgttaacggcggcgaagtt
aatctagattggaaccataccaatattacgccactaaaaactcaacaagagcgctgggaa
gaacaacaaggctactcgccctccacaacagctgcagttatttcagggctgataagcgcc
agcgatattgccactcatgctggcgataaagaagcggctaagcgctacttagcaacagct
aaaaatatgcaaggtaaaatcaatggtctgatggttacaaccgcaggtctattgtcagct
cccagcggcgtagaacgtgacaatacacaaacacaagctagtctgccctactttgtgcgc
ttagcaccaaatggagagccaaataaagataacaagcttggcgataacaatggtagagca
ggtttagatcaacgtttgattctggatggtggcttcttagagttagtgcgttatggcgtc
acttcagcaaatgataagaccatcaacaatacggttagccttattgacaatcagcagcta
gaggataacttaagagtcaaataccagttcaatgctaaagatggctcagccattccaggg
tttagacgctatggtaatgacggttacggtgaagatgaagtcaacggtaatagctacgcc
gagaggggcgtcaacacagctgggcaacgcggccgtgtttggccattctttactggagag
cgcgggcacttcgaactcgctaagttaatccaaaacaacagtttaagtaataaggaacac
caagcactcattaacacctatgtgcaaggaatggaaacttttgctaatgaagggttaatg
ctaccggagcaagtatgggatggagttggtaaccctacacgttacaactataagctaggc
caaggcactaactctgcaaccccgcttgcatggactcacgcagagtacattaagctggtg
cgctctatgtccgataaaaaagtatgggataattattcaatcgtgagcgacaaactcaag
cattag

DBGET integrated database retrieval system