KEGG   Shewanella piezotolerans WP3: swp_2769Help
Entry
swp_2769          CDS       T00791                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:swp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2906316..2908298
Genome map
AA seq 660 aa AA seqDB search
MLTTTASLDILLKEWQNERLLTPLDRHFALQMAQLHQQQSPLFILICTLLSQHLSSQHSC
LPLEQIDFSNPLKEQHSQCQINLTVDELTTELLNFDAVSTPDSAILAPLILDKGNLYLQR
YYHYECEVAEHLIRLAQAPMLKQSSSDPFDDAKILLDQLFTQNEQQYDWQKISTATALTK
RLAVITGGPGTGKTTTVTKLLYLLTSQQELTIRLVAPTGKAAARLSESIKASKQRLASEL
QHIPLDKLKSNMAQIPEEAATLHRLLGVIPNSHQFRHHKDNPLRLDLLIIDEASMVDLPM
MYKLLSALPAQASLILLGDQDQLASVEAGAVLADICSGLRVDLANGANGWQMRYSKKQAK
LLSQLTHYPLDDFISDDPQIGDSLCMLMHSHRFIGDAGIGQLAEAVNQANLPRIAQVWQT
GYKELLWLEHSNINSSSHHSNLGLEALLVQSVEQYGAYLKLIDNKAVSATEIIDSFNQYR
ILCAMRAGEYGVEGINQSVSKSLATTGLISPEQEFYAGRPVIIQSNDYNLGLFNGDIGLI
LPDDVSDSRRLMAHFIQADGGLLKVLPARLPSHETCYAMTVHKSQGSEFSHVSLVMPIRP
SLAQQQLLSKELVYTAITRAKHHFTCLGSQRIFEQASSRLTQRSSGLSERLWSKIADTCE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccacgacagcttcattggatattttacttaaagagtggcaaaacgagcgttta
ttaacaccgcttgatagacattttgcactgcagatggcgcagcttcatcagcagcaatca
ccactgtttatattgatctgcaccttgctaagccaacacctgtcgagtcagcattcctgt
ctgcccctagaacaaattgactttagtaatccacttaaagagcaacacagccaatgtcag
attaatctaacggttgatgagcttacgactgaattacttaattttgatgccgtcagcaca
cctgatagcgccatattagcaccattgatcttagacaagggtaacctgtatttacagcga
tattaccattatgaatgtgaagtggctgaacacctgatccgattagcacaagcgccgatg
ctcaaacaatcttcatcagatccgtttgatgacgctaagatattactcgatcagctattt
acccaaaatgagcaacagtatgactggcaaaagatttcaacagctactgcgttaaccaaa
cgcttagcggttatcacaggaggaccaggcacaggtaaaacaactacggtaactaagctt
ttatacctgctgacttcacagcaagaactgactatacgcttggtggctccaacggggaaa
gcggcagcgcgtttaagtgaatcaatcaaagcatctaagcagcggcttgccagcgagtta
cagcatattccattagacaagcttaaatcgaatatggcgcagatcccagaagaagccgcc
actttgcatcgactactcggcgttatccctaactcccatcaatttaggcaccataaagat
aaccctttacgacttgatctactcattatcgatgaagcatctatggttgatttgccaatg
atgtacaaattgttatcagccctgcccgcacaggcaagtctgatcctcttaggagatcaa
gaccagctggcctccgtagaagcaggcgcagtccttgctgatatttgtagcggtttaaga
gtagatttagctaatggcgcaaacggatggcagatgcgctattcaaaaaaacaggcaaaa
ttgttaagccagctaacccattatccgctagatgactttataagtgatgatccacagata
ggggatagcctttgcatgcttatgcacagtcaccgctttattggcgatgctggtattggt
caattggcagaagcggtaaaccaagctaatttaccgagaatagctcaagtgtggcaaacc
ggttacaaagagctgctttggttagaacatagcaatattaacagtagtagccatcattcg
aacctcggcctagaagctctgttagtacagtctgttgaacaatatggcgcttatcttaaa
ttgatagataataaagccgtgtccgccacagagattatcgatagcttcaatcagtatcgt
atattgtgcgctatgcgcgccggcgaatatggcgtagaggggattaaccaaagtgtcagc
aagagtcttgcaaccaccggtcttattagtcccgaacaagaattctatgctggtcgaccg
gtaatcattcaaagtaatgactataatctcggcctttttaacggtgacatagggctaatt
ttgccagatgatgtcagtgattcaagacggctaatggcgcactttattcaagccgatggt
gggcttttaaaagtactgcctgcacgcttgccaagccatgaaacttgctatgcgatgact
gttcataaaagccaaggcagtgaattcagccacgtctcgttagtcatgccaattagacca
agcctggcacaacagcagttattatcaaaagaattggtttataccgcaatcactcgcgct
aaacatcattttacctgtctcggtagtcagcgaatatttgagcaagcaagttcacgttta
actcagcgctcttcaggcttatctgaacgtctttggagcaaaatagctgacacttgcgag
taa

DBGET integrated database retrieval system