KEGG   Shewanella piezotolerans: swp_2948Help
Entry
swp_2948          CDS       T00791                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
swp  Shewanella piezotolerans
Pathway
swp00020  Citrate cycle (TCA cycle)
swp00310  Lysine degradation
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
Module
swp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    swp_2948
  Amino acid metabolism
   00310 Lysine degradation
    swp_2948
Enzymes [BR:swp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     swp_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Ribosomal_60s GCV_H
Motif
Other DBs
NCBI-ProteinID: ACJ29673
UniProt: B8CR01
Position
complement(3094890..3096080)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVQAGEQVSRDQILVDIETDKVVLEVVAPEDGQIAEFL
AEEGDTVLGEAIIANFVAGAVAGQEVTKAEAEAATPAEAEETSDALSPSVRRLIAEHNID
AAAVKGTGVGGRITKEDVEAFVKNAKAAPAPTSAPAAVAAPLAERSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEIFEKRHGIRLGFMSFYVKAVTEALKRF
PEVNASIDGDEIVYHNYFDVSIAVSTPRGLVTPVLRDTDKMSLADIERNVRELALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGYLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtactgccagaatctgttgctgatgcaactattgct
acttggcacgttcaagctggcgagcaagtttctcgtgatcaaatccttgttgatattgaa
actgataaagtagtacttgaagttgttgcacctgaagatggtcagattgctgaattcctt
gcggaagagggcgatacagtcttaggcgaagcgattattgctaactttgttgctggtgct
gttgctggtcaagaagtgactaaagcagaagctgaagcggcaacaccagcagaagctgaa
gagacaagtgatgcgctaagcccatcagtacgtcgcttaattgctgagcataatattgat
gctgcagcggttaaaggtacaggtgtgggcgggcgtattactaaagaagatgttgaagcc
ttcgttaagaatgctaaagcagctcctgcaccaacaagtgctcctgctgctgtagctgcg
ccgcttgctgaacgtagcgaaaagcgtgtaccgatgacacgtcttcgcaagacgattgct
aatcgtctgctagaggctaaaaactcaactgcgatgctaacgacgtttaacgaagttaac
atgaagccaattatggatattcgtaagcagtatcaagagatttttgagaagcgtcacggc
atccgtttaggctttatgtctttctacgttaaagcggtgactgaagcacttaagcgcttc
cctgaagttaacgcttcaattgatggcgatgaaattgtttatcacaactactttgatgtc
agcattgccgtttcaacgccacgtggccttgtaacaccagtactacgtgataccgataag
atgagccttgccgatattgaacgtaatgttcgtgaattagcacttaaaggacgtgacggt
aaattaaccgttgctgacatgactggtggtaacttcactgtgactaacggcggtgtattt
ggttcattgatgtcaactccaattttgaacctgccacaaagcgcgattcttggcatgcac
gccattaaagatcgccctatggcagttaatggtcaggttgaaatcctgcctatgatgtac
ctcgcactttcttacgaccaccgtatcgtagatggtcgtgagtcggttggttatttggtt
gccattaaagacttcctagaagacccaactcgtctgttacttgacctttaa

DBGET integrated database retrieval system