KEGG   Shewanella piezotolerans: swp_2953Help
Entry
swp_2953          CDS       T00791                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic subunit, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
swp  Shewanella piezotolerans
Pathway
swp00020  Citrate cycle (TCA cycle)
swp00190  Oxidative phosphorylation
swp00650  Butanoate metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
Module
swp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
swp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    swp_2953
   00650 Butanoate metabolism
    swp_2953
  Energy metabolism
   00190 Oxidative phosphorylation
    swp_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACJ29677
UniProt: B8CR05
Position
complement(3101628..3101975)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASLGRSGVHDFILIRASAVILACYTIFMVGFIACSSPLTYDAWHGLFSALPMKVF
TLLALVAILVHAWIGIWQVLTDYVKCVSLRGVLQFVFVVAAFSYLAAGILIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaaatgcagcaagtcttggtcgcagcggtgtccatgactttattcttatacgt
gcaagtgcagtaattctagcctgttacactatttttatggttggttttatcgcatgtagc
tctccactgacttatgatgcatggcacggattgttcagtgctctgccaatgaaagtcttc
acacttctcgcactggttgcgattctagtccatgcatggattggtatttggcaggtactt
accgattacgttaagtgtgtgtctctacgtggtgtacttcagtttgtttttgtcgtagca
gccttttcttatttggcagcaggcattttgatagtgtggggtgtttaa

DBGET integrated database retrieval system