KEGG   Shewanella piezotolerans: swp_2983Help
Entry
swp_2983          CDS       T00791                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
swp  Shewanella piezotolerans
Pathway
swp00010  Glycolysis / Gluconeogenesis
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_2983
Enzymes [BR:swp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     swp_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim YiiD_C Mito_fiss_Elm1
Motif
Other DBs
NCBI-ProteinID: ACJ29703
UniProt: B8CR31
Position
3129140..3129985
Genome map
AA seq 281 aa AA seqDB search
MGSVTTKKHANGLEYVEINTAQCKARIFLQGAQIDYFEPVGKEPLLWVSSADDYQVGSGI
RGGVPVCWPWFGMSPNPGFPQHGFARTSIWTLDSVKMLDEAVEVKFTLPISDSDTQYWPH
DTSVELLFRLSETLSVSLTNINHGDYEVSLTQALHSYFPIEDIHQLTATGFSDSKYIEFG
KGPFNQAQDDVDFNRETDRVYTNLGPVQQLHTRKGIIEVSRENSHSAVLWNPWIDKSQRL
SRFNDDDYLSMVCLEAANVLEDKVTLAPKESHTLTTHIRWK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggtcaccactaaaaagcacgccaatggtcttgaatatgttgaaataaataca
gctcaatgcaaggctagaatttttctacagggtgcgcaaattgactactttgaaccagta
ggaaaagaacctctgttatgggtttcaagtgccgatgattatcaagttggaagtggtatt
cgcggcggtgtaccagtatgttggccatggtttggtatgagccctaatccaggttttcct
cagcacggatttgctcgaaccagtatatggacactcgactcggtaaaaatgctagatgag
gctgtggaggtcaagtttaccctaccaatttcggactcagatacgcaatactggccccac
gataccagtgtagagttgctatttcgccttagcgaaaccctgtcagtgagcctaacaaat
attaaccatggtgattatgaagtcagtttgacccaagcgctgcatagctatttccctatt
gaagatatccatcaattaacggcaactgggttttcagattcaaaatacatcgaatttggc
aaaggcccttttaatcaagcgcaggatgacgttgattttaaccgtgaaacagaccgagtt
tataccaacctaggcccagtacaacaacttcatacccgtaaagggattatagaagtcagc
cgcgagaatagtcatagcgcggtattatggaacccatggatagataaatcacaacgatta
tcgcgctttaatgatgatgattacttgtctatggtctgccttgaggctgcgaatgtgctt
gaagacaaagtgacacttgcgccaaaagaaagtcatacattaacaacacacattcgctgg
aaatag

DBGET integrated database retrieval system