KEGG   Shewanella piezotolerans: swp_2983Help
Entry
swp_2983          CDS       T00791                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
swp  Shewanella piezotolerans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_2983
Enzymes [BR:swp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     swp_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3129140..3129985
Genome map
AA seq 281 aa AA seqDB search
MGSVTTKKHANGLEYVEINTAQCKARIFLQGAQIDYFEPVGKEPLLWVSSADDYQVGSGI
RGGVPVCWPWFGMSPNPGFPQHGFARTSIWTLDSVKMLDEAVEVKFTLPISDSDTQYWPH
DTSVELLFRLSETLSVSLTNINHGDYEVSLTQALHSYFPIEDIHQLTATGFSDSKYIEFG
KGPFNQAQDDVDFNRETDRVYTNLGPVQQLHTRKGIIEVSRENSHSAVLWNPWIDKSQRL
SRFNDDDYLSMVCLEAANVLEDKVTLAPKESHTLTTHIRWK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggtcaccactaaaaagcacgccaatggtcttgaatatgttgaaataaataca
gctcaatgcaaggctagaatttttctacagggtgcgcaaattgactactttgaaccagta
ggaaaagaacctctgttatgggtttcaagtgccgatgattatcaagttggaagtggtatt
cgcggcggtgtaccagtatgttggccatggtttggtatgagccctaatccaggttttcct
cagcacggatttgctcgaaccagtatatggacactcgactcggtaaaaatgctagatgag
gctgtggaggtcaagtttaccctaccaatttcggactcagatacgcaatactggccccac
gataccagtgtagagttgctatttcgccttagcgaaaccctgtcagtgagcctaacaaat
attaaccatggtgattatgaagtcagtttgacccaagcgctgcatagctatttccctatt
gaagatatccatcaattaacggcaactgggttttcagattcaaaatacatcgaatttggc
aaaggcccttttaatcaagcgcaggatgacgttgattttaaccgtgaaacagaccgagtt
tataccaacctaggcccagtacaacaacttcatacccgtaaagggattatagaagtcagc
cgcgagaatagtcatagcgcggtattatggaacccatggatagataaatcacaacgatta
tcgcgctttaatgatgatgattacttgtctatggtctgccttgaggctgcgaatgtgctt
gaagacaaagtgacacttgcgccaaaagaaagtcatacattaacaacacacattcgctgg
aaatag

DBGET integrated database retrieval system