KEGG   Shewanella piezotolerans: swp_3003Help
Entry
swp_3003          CDS       T00791                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23 2.6.1.9)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
swp  Shewanella piezotolerans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    swp_3003 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    swp_3003 (hisD)
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     swp_3003 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3156099..3157418
Genome map
AA seq 439 aa AA seqDB search
MDILNWQTLTATAKQDALARSPLIGDSNLEQTVANIIDEVVTDGDNALRNFAKQFDGVNI
ENLKLSKEQIAQACQAVPAELKQAIAQARANIDSFHQAQVSSPVDVETQIGIRCELRSEP
IEKVGLYIPGGTAPLISTVLMLALPAKIAGCSKRILVSPPPINNAIVYAADACGITEIYQ
VGGAQAIAALAFGTDSVPQVDKIFGPGNRFVTEAKRAVSQDSRATVSIDMPAGPSEVLVI
ADAKANASFVAADLLSQAEHGPDSQVMLVTDSIEVANKVNQALEQQLSELSRAEVATTAL
SCSRTLLVNDMTEAAQVSNLYGPEHLIIQTEQPRAVLANIRAAGSVFLGAYTPESVGDYA
SGTNHVLPTYGYSKTVSSLSLADFSRRFTVQELTADGLASIGNAVMTLAAAEQLDAHKNA
VALRLASLNIANNDTSEAS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggacattctcaattggcaaacgttaacggcaacggctaaacaagacgcactggcaaga
tcgccgctcatcggcgactcaaaccttgaacaaactgttgctaacattatcgatgaggta
gtgactgatggcgacaatgcattgcgcaattttgccaaacagtttgacggcgttaatatc
gagaaccttaagctatcaaaggagcaaatagctcaagcttgccaagctgtaccagcggag
cttaaacaagcgatagctcaagctagagccaatatagatagctttcaccaagcgcaggtc
tctagccctgttgatgttgaaacccagataggtattcgctgcgagctaagaagtgagcca
attgagaaagtcggcctctatatacccggcggcacagcgccgttaatttcgacggtttta
atgttggcactaccggccaaaattgctggttgtagcaaacgcattttagtcagtcctcca
cctattaataatgctatcgtctatgcagcagatgcttgtggcatcactgagatctatcaa
gttggcggtgcacaagcgattgcagcccttgcctttggcactgattcagtgcctcaagtt
gataaaatattcggtccaggtaaccgttttgtcactgaagctaaacgtgcagttagccaa
gatagccgtgcaacggtcagtatcgatatgccagcaggcccttcagaggtgctagtcata
gcagatgcaaaagccaatgccagctttgtggcagctgacctgctatctcaagccgagcac
ggacctgactcgcaagtgatgttagtgacagactctatcgaagttgccaataaggttaat
caagcattagagcagcaactgtctgagctttcacgcgctgaagttgccactacggcacta
agctgtagccgtacgctgctggtcaatgatatgacggaggcagcacaggtctctaaccta
tacgggcctgaacacctgattatccaaaccgagcagccaagggccgtattagcgaatatt
cgtgctgcgggctcagtatttctaggggcttatacgccggagtcagttggagattacgcc
agtggaactaaccacgtattgccgacatatggctacagcaaaacggtgtcaagtttgtcg
ctagcagattttagccgccgttttacggtacaagagctaactgcggacggcctcgcgagc
ataggcaatgccgtgatgacactcgccgctgcagaacaactcgatgctcacaaaaatgca
gtggcgctgcgtcttgcatcgcttaatatcgctaacaacgatacttcggaggcatcatga

DBGET integrated database retrieval system