KEGG   Shewanella piezotolerans: swp_3090Help
Entry
swp_3090          CDS       T00791                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     swp_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3234806..3235771
Genome map
AA seq 321 aa AA seqDB search
MLKHQIPTTPTNYALWYAYVGQSSPELNRQLDEVVNQYSTCPPSQGERLYQAYLSDPIEL
DVIELRQNLDAMVTDLSQSLKDTNVDANQFQSKINSNVERLNKIENEGFSIDEVLSLVKN
LVSDAADIKNSTLHFTEQLAHAQSEINQLKVQLKKSEHDMHYDALTGALNRRAFNKDIKG
LVEQNPQGLCLIITDIDHFKLFNDTYGHQLGDQVLKAVARRLGESCHEGSKLYRFGGEEF
ALLVPKSQLGRARQLAESMRRSLEKLVLKDKRKDQRVDNVRASFGVAQYQDKDSDSTLIE
RADKQLYEAKRLGRNRVMPIT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaccaaataccaaccactcctaccaattacgctttatggtatgcgtacgta
ggtcaaagcagcccagagcttaatcgacagctagatgaagtcgtgaaccaatatagcact
tgccctccgagtcagggagagcgactctatcaagcatatttgtctgatcccatcgagcta
gacgtgattgaattacgacagaatctcgacgctatggtgaccgatttatcccagtcttta
aaagatactaacgttgatgctaaccagtttcagagcaaaattaacagcaatgttgagcgc
ttaaacaaaatagaaaatgaagggttttccattgatgaggtattgtcattggtaaaaaac
ctcgtcagtgatgctgccgatattaaaaacagcacattgcactttaccgagcagctcgct
cacgcacaatcagagattaaccagttaaaagtacagcttaaaaaatctgaacatgacatg
cattatgatgcgttaacgggcgcattaaaccgcagagcatttaataaagatatcaaagga
ttagtggaacaaaatccacagggcttatgcctcatcatcaccgacattgatcactttaaa
ctgtttaacgatacctatggccaccagcttggcgatcaagtattgaaagccgttgctaga
agactcggcgagagctgtcatgaggggagtaaactgtatcgttttggcggtgaggagttt
gcacttttagtccccaaaagccaactaggaagagcgagacaactggcagaatctatgcgt
cgaagcctcgaaaaactagtattaaaagataagcgtaaagatcaacgggtcgataatgtg
agagcctcttttggcgttgctcagtaccaagataaagacagtgattcaacattaatcgag
cgggcggacaagcaactctatgaagctaaaaggctgggtcgtaaccgagtaatgcccatt
acttaa

DBGET integrated database retrieval system