KEGG   Shewanella piezotolerans: swp_3683Help
Entry
swp_3683          CDS       T00791                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
swp  Shewanella piezotolerans
Pathway
swp00220  Arginine biosynthesis
swp00250  Alanine, aspartate and glutamate metabolism
swp00471  D-Glutamine and D-glutamate metabolism
swp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    swp_3683
   00220 Arginine biosynthesis
    swp_3683
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    swp_3683
Enzymes [BR:swp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     swp_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACJ30370
UniProt: B8CS80
Position
complement(3897839..3898753)
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEVIEKVRPLLGQGKVADYIPALAEINANKLGIAVTTRDGVTIGAGDYLEPFS
IQSISKVFSLTLALMHYEEPEIWSRVGKEPSGQSFNSLVQVELEKGLPRNPFINAGALVI
ADLLQGRLGAPKQRMLEIVRGLSDNQRIGYDKTVARSEYQHSARNAAIAYLMKSFGNFNN
DVDTVLKSYFHYCSLRMSCADLSKAMIYLANGGKSLAGKQLITPVQTRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSVCVWSPELDTNGNSLAGTAALETLSQTLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctggcattgcttgaagaggttattgaaaaagtacgacctcttttaggtcaa
ggtaaagtggctgattatattccagctcttgctgagatcaatgccaataagctcggtatc
gccgtgacgactagagatggtgtcacaataggggctggagattatctcgagcccttttca
attcagagtatttcgaaagtcttcagtttaacgctggcactaatgcattacgaagagcct
gaaatttggtctcgggtaggcaaagaaccatcgggccagtcatttaactctttggtgcaa
gttgagttagaaaaaggactaccgcgtaatccatttattaatgcgggtgctttggttatt
gcagacctattgcaaggccgcttaggcgcgccgaaacagagaatgttggagattgtccgc
gggctgagtgataatcaaaggattggctacgacaaaacggttgccagatctgaatatcag
catagtgcgcgtaatgccgctatcgcatatctgatgaagtcattcggtaacttcaacaat
gatgtcgacactgtccttaagagttattttcattattgctccttgagaatgagctgcgcc
gatctgtctaaagccatgatctatcttgctaatggtggaaagagtttggcgggtaaacaa
ctaataacgccagtgcagacaaggcagttaaatgcgttgctagcaacttcaggcttatat
gatggtgctggagagtttgcctatcgtgttggcatgcctgggaaaagtggcgtaggtggt
gggatcattgctgtgatccccggtgatatgtcggtatgtgtttggtctccagagctcgat
actaatggcaattcacttgctggaaccgcagcgcttgagacccttagtcagacattgggt
cgttcaattttttag

DBGET integrated database retrieval system