KEGG   Shewanella piezotolerans WP3: swp_3895Help
Entry
swp_3895          CDS       T00791                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:swp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4106029..4106883
Genome map
AA seq 284 aa AA seqDB search
MTAALSLGWPAPAKLNLFLHINGRREDGYHELQTLFQFIEHCDFLDFKVTENTNLKLHSN
MSTVVADNDNLILRAAKSLQEYSQCQQGAEIWLDKRLPMGGGLGGGSSDAATTLVALNSL
WGLNIPIDELAKIGLKLGADVPVFINGFSAFAEGVGEQLQPVYPPQPWYLVVVPDVHVST
AEIFQDPALPRNTPKHSLTSLMESPWKNDCQELVAKHSPQVAKALAWLLEYAPSRMTGTG
ACVFGQFEQEQQAKDALAKLPTSMNGFVAKGANKSPLMLRLAQC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcactttcattaggttggcctgcaccagccaaactcaaccttttcctgcat
atcaatggtcgccgcgaagatggttatcacgaactgcaaacactgtttcaatttatcgag
cattgtgactttctcgactttaaggttactgagaacacaaatttgaaactgcattcaaat
atgtctactgttgtcgccgataacgataacttaattctgcgagccgcaaaatcgttgcaa
gagtatagccaatgccaacaaggcgctgaaatttggttagataaacgcttgcccatggga
ggcggtttaggtggaggttcatccgatgcggcaaccactttagtcgcactaaattcgctt
tgggggctgaatatccccatagatgaacttgccaaaataggactaaagcttggcgctgat
gtccctgtttttattaatggtttctcagcttttgctgaaggtgttggtgagcaattacag
cccgtttaccctcctcagccttggtaccttgtagtggtgccagatgtgcatgtatcaaca
gccgaaattttccaagatccagcattgcctcgcaatactcccaagcattcattaacttcc
ttaatggaaagcccatggaaaaatgattgccaagaactggtcgcaaaacactctccccaa
gttgccaaagccttagcgtggctgctagaatatgcgccgtccagaatgaccggaaccgga
gcatgtgttttcggtcaattcgaacaggagcaacaagctaaagacgccttggcaaaactg
cctacgtcgatgaatggctttgttgccaaaggggcaaataaatcgccattaatgctgaga
ttagctcagtgttaa

DBGET integrated database retrieval system