KEGG   Shewanella piezotolerans: swp_4227Help
Entry
swp_4227          CDS       T00791                                 

Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     swp_4227
Secretion system [BR:swp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   swp_4227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4428555..4429289)
Genome map
AA seq 244 aa AA seqDB search
MKFTRAFSLIIAMVIAPAALAGSNTQSDDTAAIKQKLSDTLSVDVMSLKESPIPGLYEAL
TNRGVLYISKDGTKLLHGNLYDLDKGMKNLTEAAMSGPRIDMMKPLEKNMLVYKAKNEKH
VVTVFTDVDCGYCRKLHNQMDEYNDLGITVRYLAFPRAGIPSANADEMEAVWCAADPLQA
MTDAKSGKSVKVAKCDAKIAEQYNLGQTFGINGTPAIVLEDGSLIPGYQPPKDLLRVLDA
AAAE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacccgagcattttctttgatcattgcaatggtcatagcccctgcagccctt
gccgggtcaaatacccaaagtgatgacactgcggcgataaaacagaagttgtctgataca
ttaagcgtagatgtgatgtcgctgaaagagtcgccaattcctggtttgtatgaagcccta
accaatcgtggtgtgctgtatattagtaaagatggtactaagctgttgcacggaaatctt
tatgacttagataaaggcatgaagaacctaaccgaagcagcgatgtcaggtccacgtatt
gacatgatgaaacctcttgagaagaacatgttggtttataaagccaagaatgaaaagcat
gttgttacggtgtttactgatgttgattgtggttactgccgcaagttacataatcaaatg
gatgaatataacgatctcggcattacagttagatacttagcattcccacgagcaggtatt
ccatcagctaatgctgacgagatggaagctgtttggtgcgctgccgatccattgcaagcg
atgactgatgctaagtcggggaagtcagttaaagtggctaagtgtgatgcgaaaattgca
gagcaatataatcttggccaaacctttggtattaatggaacacctgcaatcgtgcttgag
gatggcagcttgatcccaggttaccaaccgcctaaagatctattaagagtgctagatgct
gcagccgcagagtaa

DBGET integrated database retrieval system