KEGG   Shewanella piezotolerans WP3: swp_4227Help
Entry
swp_4227          CDS       T00791                                 

Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
swp  Shewanella piezotolerans WP3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4428555..4429289)
Genome map
AA seq 244 aa AA seqDB search
MKFTRAFSLIIAMVIAPAALAGSNTQSDDTAAIKQKLSDTLSVDVMSLKESPIPGLYEAL
TNRGVLYISKDGTKLLHGNLYDLDKGMKNLTEAAMSGPRIDMMKPLEKNMLVYKAKNEKH
VVTVFTDVDCGYCRKLHNQMDEYNDLGITVRYLAFPRAGIPSANADEMEAVWCAADPLQA
MTDAKSGKSVKVAKCDAKIAEQYNLGQTFGINGTPAIVLEDGSLIPGYQPPKDLLRVLDA
AAAE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacccgagcattttctttgatcattgcaatggtcatagcccctgcagccctt
gccgggtcaaatacccaaagtgatgacactgcggcgataaaacagaagttgtctgataca
ttaagcgtagatgtgatgtcgctgaaagagtcgccaattcctggtttgtatgaagcccta
accaatcgtggtgtgctgtatattagtaaagatggtactaagctgttgcacggaaatctt
tatgacttagataaaggcatgaagaacctaaccgaagcagcgatgtcaggtccacgtatt
gacatgatgaaacctcttgagaagaacatgttggtttataaagccaagaatgaaaagcat
gttgttacggtgtttactgatgttgattgtggttactgccgcaagttacataatcaaatg
gatgaatataacgatctcggcattacagttagatacttagcattcccacgagcaggtatt
ccatcagctaatgctgacgagatggaagctgtttggtgcgctgccgatccattgcaagcg
atgactgatgctaagtcggggaagtcagttaaagtggctaagtgtgatgcgaaaattgca
gagcaatataatcttggccaaacctttggtattaatggaacacctgcaatcgtgcttgag
gatggcagcttgatcccaggttaccaaccgcctaaagatctattaagagtgctagatgct
gcagccgcagagtaa

DBGET integrated database retrieval system