KEGG   Shewanella piezotolerans: swp_4477Help
Entry
swp_4477          CDS       T00791                                 

Definition
cold-active alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
swp  Shewanella piezotolerans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    swp_4477
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    swp_4477
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    swp_4477
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     swp_4477
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   swp_4477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4692916..4694220
Genome map
AA seq 434 aa AA seqDB search
MTFRNTFTWVLSALAILPLYATANIDITEAPSRPKNMIIMVGDGMGPAYTSAYRYFQNNP
DTEEIEQTVFDRLLVGMASTYPAKESGYVTDSAASATALATGFKSYNGAISVDTNKRPLT
TIMQMAKSRGMSTGVAVTSQVNHATPAAFLVHNESRRNYEAIATDMLQSDADVILGGGQK
YFSEALLGQFKTKGYQHIDDLAQLESIAKPKVIGLFAEVQLPWVINDVDANTLSRLTQKS
LELLSQNDKGFVLLVEGSLIDWAGHNNDIATAMAEMQSFANAMEVVEQYVRQHPDTLLVA
TADHNTGGLSIGANGEYAWDSELLKGISASPSNISATAIASDEWQTGVSKSLGFELSASE
LQQLSNARMQGDEALQTALKKLIDVRSNTGWTTSGHTGGDVQVFAVGPAADLFKGNQDNT
QIAEKMMTLLPKKD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacttttagaaacacttttacttgggtccttagtgcccttgccatattgccgctgtat
gcaacagccaatatcgatataactgaagcaccatcacggcctaagaatatgatcatcatg
gttggcgatggcatggggccagcttataccagtgcctatcgatattttcagaacaaccct
gataccgaagagattgagcagacggtgtttgatcgtttattagtgggaatggcttcgact
taccccgctaaggagagcggttatgtaactgattcagcagcatcagcgaccgcacttgcc
acaggctttaagagctacaatggtgccatctctgtcgataccaataaacgcccattgacc
actatcatgcagatggcaaaatcccgcggcatgtcaacgggtgtggctgttacctcacag
gtaaaccatgcgacgccagcagcctttttagtgcataacgaaagccgccgcaactatgaa
gcgattgccacagacatgctgcaatctgatgccgatgtgattttaggtggtgggcaaaaa
tacttctctgaagcactattaggccagttcaaaaccaaaggctatcaacatatcgatgac
ttagcacagcttgaatccattgctaaacccaaagttatagggctatttgccgaggtgcaa
ctcccttgggtgataaacgatgtggacgccaataccttaagccgtttaacccaaaagtct
ttagagctactatcacaaaatgacaaaggtttcgtgttattagtcgaaggcagtttgatt
gattgggctggacacaataatgatatcgcaaccgccatggccgaaatgcagagctttgct
aacgcaatggaggttgtagagcaatatgttcgccaacacccagatactttgttggtggct
actgctgatcataatactggtgggctttctataggtgcaaatggcgaatatgcttgggac
tctgagctactaaaagggattagtgctagcccctcaaatattagtgcaactgccattgcc
agtgacgagtggcaaactggggttagtaaaagccttggtttcgagttgagcgcttcagag
ttgcaacaattaagcaatgcacgtatgcagggcgatgaagctctacaaactgcacttaag
aaactgattgatgtccgcagtaatactggttggacgacaagtggccacactggtggcgat
gtgcaagtatttgccgtagggcctgcagcagatttgtttaaaggcaatcaagacaacacc
caaatagctgaaaaaatgatgactctgctaccgaaaaaagactag

DBGET integrated database retrieval system