KEGG   Shewanella piezotolerans: swp_4524Help
Entry
swp_4524          CDS       T00791                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
swp  Shewanella piezotolerans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    swp_4524
  Lipid metabolism
   00600 Sphingolipid metabolism
    swp_4524
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    swp_4524
Enzymes [BR:swp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     swp_4524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4744452..4747682
Genome map
AA seq 1076 aa AA seqDB search
MLTTPRTRQFHPLLKQARVHLSYAKIISLLAVSLISPQSIAQAERWQDHLVFEQNKQPPH
ASFFGYSSLSKAIVDDYQASNNFLDLNGRWQFHYAKNPFVAPKDFAQQQAKLDDWQSIQV
PGNWETQGFGHAIYLDERYPFTTTWPNAPEDHNPTGSYRRQFELPKEWQNKQVFLHIGAA
RSALSAHINGVEVGYSQGAKTPAEFDITPHLNQGENLLALQIIRWSDASYLESQDMLRVS
GIERDVYLYATEKQRIADIDATYTLNKNLTKANMAIKIKLNNHAKTAIKAGELNLEYQLL
SPQGASAKLGQQAVAEFNNNVDQTLTLSVENPALWSAETPLLYQLLISLKAADGTLLQAS
SQKIGFRRVEIKQGQLLVNNKAITIRGVDRHETDPDTGHVVSRTSMETDIRLMKQNNINA
VRSSHYPNDPYWLSLTDKYGLYVIDEANIESHPLAIDEKTQLGNEMSWLPAHQARIERMI
ERDKNHPSIIIWSLGNEAGEGHLFEALYDWVKQRDPSRPVQYEPAGQHAYTDIVAPMYPS
IERIEKYAKTHNDRPLIMIEYAHAMGNSVGNLQDYWDVIERYPQLQGGFIWDWVDQSLAF
TNSNGQRYWAYGKDYHPDMPTDGNFLNNGLVDPDRNPHPHLSEVKKVYQPLRFNNFVVNT
DSASFELENRYDFISTQNLQLKWTIQQDGRPFSVGSIEMPMVKAGLSKQIILPLDQSQFA
GHFEYQLLLEVLVDKPQPMLPSDHRIAFGQFSLQAASNKPHTLAVAIKQQDSFWQLGNEQ
LQYLISKKTGWLTDIKQAGQSQLTAPLMVNFWRAPTDNDLGNQMPEWAGAWQDAAKELRL
LSIKRINPYSIEVQQQHPTLDFSLNTRYQISTAGQLLVQSQFKPGTVELADLPRFGFQTQ
LPFSQRFMHYFGRGPEETYADRKSGNPLGWFALPIEQTFHRYSRPQETGQRTDVRYVAIT
DSKGKGLLAKTNADNTTLQTSLWPFAQADIDFRQGDASGSASGLVPVTVNHGAEITTQKF
VTWNIDHKQMGVGGDTSWGRQVHRPYRIKAEPMEFKFTIEPLAAAADIQQQARTKP
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgctaactacacctcgaacccgacagtttcaccccttattaaaacaagcacgtgtgcat
cttagttacgccaaaattattagcttattagcagtgagcctaataagccctcaatccata
gctcaggcggagcgatggcaagatcaccttgtttttgaacaaaataaacagccaccccac
gccagcttttttggctactcttcattatcaaaagcaattgtcgatgattatcaagccagt
aataactttcttgatctcaatgggcgctggcaatttcattacgctaaaaacccatttgtg
gcgcctaaagattttgctcaacaacaggctaagctagatgactggcaaagcatacaagta
ccgggtaactgggagacccaaggttttggtcatgccatctatctagatgaacgctaccct
ttcactactacttggcccaatgctccagaagatcacaaccctacaggtagctaccgccga
caatttgagttacccaaagagtggcaaaacaagcaagtatttctgcatattggcgcggca
cgttcagcgttaagcgcgcatataaacggtgtggaagtcggatatagccaaggggcaaaa
acaccggccgagtttgatattactccccaccttaaccaaggtgaaaacttgctagccctg
cagataatacgttggagtgatgccagttatctcgagagccaagatatgctgcgagtcagt
ggtattgaacgtgatgtatatctttacgctacagagaagcagcgtatcgctgatatcgac
gcaacttatacgctcaataaaaatctcaccaaagccaatatggcgattaaaattaagctt
aacaatcatgctaaaaccgctattaaagctggggagctaaacctagagtaccagctgctt
tctcctcaaggggctagcgctaaattgggccaacaagctgtcgctgagtttaataacaat
gttgaccaaacccttactttatctgtcgaaaaccccgccctttggagtgcggaaacccca
ttgttatatcagctattaataagcctaaaagcagcggatggcacactgctgcaggccagt
agccagaagataggctttcgccgagtagagataaaacaaggtcaactactggtcaataac
aaggccattaccatacgcggtgtcgataggcatgaaaccgaccccgataccggccatgtg
gtaagtcggactagcatggaaactgacatccgtttaatgaagcagaacaacatcaatgcc
gtgcgttcaagtcactaccctaatgacccctactggctgagcttaaccgacaaatatggt
ctgtatgttatcgatgaagccaatatcgaatcgcacccattagcgattgacgaaaagact
caactcggaaacgagatgagttggttaccagcgcatcaagcacgtattgagcgcatgatt
gagcgtgataaaaaccatccctctatcattatctggtcgctaggtaatgaggcaggagaa
ggtcatttatttgaagcattatatgattgggttaaacaacgcgatccgagtcgtcctgtg
caatacgaacccgctggtcaacatgcctatactgatatcgttgctcctatgtacccgtca
atcgagcggattgagaaatacgctaaaacccataacgatcggccattgattatgatcgaa
tacgcccacgctatggggaactcggtgggaaatttacaggattattgggatgtcatagag
cgctacccgcaactacaaggcggctttatctgggactgggtggatcaatccttagccttt
accaactctaacggccaacgctattgggcttatggcaaagattaccaccctgatatgcca
actgacggtaactttctcaataatggtctggttgatcctgaccgtaatccacacccgcat
ttaagtgaagttaagaaggtttaccaaccactacgtttcaacaattttgtggtcaatact
gattcggctagttttgaacttgaaaaccgctatgactttattagcactcaaaacttacaa
ctaaaatggacaatccagcaggatggtcgcccgtttagcgtcggcagcattgagatgccg
atggtaaaagctggcttatctaagcaaataatcctgccgctagatcagagtcagttcgct
ggccattttgaataccagttgttgctcgaggtgctagttgataagcctcaacctatgcta
cctagtgatcaccgcatcgcatttggtcagttttctttgcaagccgccagcaataagcca
cataccttagcggtggcaataaagcagcaagatagcttttggcagttaggtaatgagcaa
ctccaataccttatctctaaaaaaacaggttggctcaccgatatcaagcaagcaggccaa
tcccaactaaccgcaccactaatggttaacttctggcgtgcaccaaccgataatgattta
ggtaatcagatgcccgaatgggcaggcgcttggcaagatgctgcaaaggagctgaggcta
ctatcgattaaacgcattaatccctacagtattgaggttcagcaacagcatccgacctta
gatttcagtcttaacactcggtaccaaatcagtacagcaggtcaattgctggtacaaagt
cagtttaaacctgggacggtagaacttgctgatcttccccgctttggctttcaaacacag
ctgccttttagccagcgctttatgcattactttggtcgtggtcctgaagaaacctacgca
gatagaaagtcaggtaatcccctaggttggtttgcactgcctatcgagcaaacctttcac
cgttactctcgcccacaagaaacaggccaacgcactgatgtgcggtatgtggcaattact
gatagtaagggtaaaggattactagccaaaaccaatgcagacaataccactttgcaaacc
agcctttggccctttgcacaagccgatatcgacttcagacaaggagacgcgtcaggctca
gcttcggggctcgtgcccgttaccgtcaatcacggcgctgaaataacaactcaaaagttt
gtcacttggaatattgaccataaacagatgggtgtaggcggcgatacctcttggggcaga
caggtccaccggccctatcgcatcaaagctgagccgatggagtttaaatttaccattgaa
ccgctagcggccgcagctgatattcaacaacaagcaagaacaaaaccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system