KEGG   Shewanella piezotolerans: swp_4608Help
Entry
swp_4608          CDS       T00791                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     swp_4608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4846880..4847920)
Genome map
AA seq 346 aa AA seqDB search
MIFKYRWAIAAVIVICFSGYLYLSFKEQTSFVNKVESNKKQSSLEQTDTPPHYASIVAVP
TFVFEQEQKPHIALGLRLFLDPQLSSNGEVSCESCHHIYDNGAEDIRVSKGVKGEGNRNS
PTVFNIGLNTRFFWDGRANSLYEQIDGPIHNPLEMNSNWGDIAARLSSQASYQSAFAKHY
DEVITEDTIKDALITFMMQLNTPGAPFDKYLKGEANAMPQAAILGWEKFQDLGCIYCHQG
RNIGGNLFQKFGSVEPVETLNSDLGRYQQTNDINDKYVYRVPSLRNVALTPPYFHDGRAQ
SLEEAVLVMAKVQLGKDLEATTVVELIAFLDSLTAPNPPILKELRK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatattcaaatatcgctgggcgattgcagctgtcatcgtgatctgtttcagcggatat
ctttatctaagctttaaagaacagacaagttttgttaacaaggttgaaagtaacaaaaag
caatcttctttagagcaaactgacactcctcctcattatgcctcaattgtcgctgttccc
acatttgtattcgaacaagagcaaaagcctcatatcgctttaggtctaagacttttcttg
gatcctcaattgtcctcaaatggcgaagtaagctgcgagtcttgccaccatatttacgat
aatggagcggaagatattagggtttccaaaggagtgaaaggcgagggcaatcggaactca
ccgacagtctttaatattggtttgaacactcgttttttttgggacggacgtgcaaatagc
ttatatgaacagatagatggcccgattcacaatccattagagatgaacagcaattggggg
gatattgcagcgcggctatccagtcaggcgagttaccaaagtgcatttgctaaacattat
gatgaggtgatcaccgaagacaccataaaagatgcattaatcacctttatgatgcagctc
aatacaccaggtgcgccgtttgataaatacctaaagggtgaagccaatgctatgccccaa
gccgctatcttagggtgggaaaagtttcaggatttgggctgcatttattgtcatcaaggg
cgcaatattggtggtaacttatttcaaaagtttggcagtgtggagccggtagaaaccctt
aatagcgatctcgggcgttaccagcaaaccaatgatattaacgataaatatgtttatcgc
gtaccgagtttaaggaacgtagcacttactcctccctactttcatgatggacgggctcaa
agcttagaagaggctgtcttagtgatggcaaaagtccaactaggcaaggacttggaagcg
acaacggtagtggagctcattgcattccttgattcacttacggcccctaaccctcctatt
cttaaggagctgagaaaatga

DBGET integrated database retrieval system