KEGG   Shewanella piezotolerans: swp_4821Help
Entry
swp_4821          CDS       T00791                                 

Definition
(GenBank) Peptidase S24, LexA repressor
  KO
K01356  
repressor LexA [EC:3.4.21.88]
Organism
swp  Shewanella piezotolerans
Module
Fluoroquinolone resistance, gyrase-protecting protein Qnr
Brite
Enzymes [BR:swp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     swp_4821
Peptidases [BR:swp01002]
 Serine Peptidases
  Family S24: LexA family
   swp_4821
DNA repair and recombination proteins [BR:swp03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    swp_4821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5049919..5050539
Genome map
AA seq 206 aa AA seqDB search
MRPLTPRQAEILELIKRNISDTGMPPTRAEIARRLGFKSANAAEEHLKALAKKGCIEIIP
GTSRGIRLTQEEPEEVELGLPLIGQVAAGEPILAQEHVEQHYKVDPAMFRPSADFLLRVR
GDSMKDIGILEGDLLAVHKSQQARNGQVVVARVEDDVTVKRFEKKGNKVFLHAENEEYSP
IEVDLANQSLSIEGLAVGVIRNGDWQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagaccacttacaccgcgccaagcagaaattttagagttgattaaacgaaacatttca
gacacaggtatgccaccgactcgtgctgaaatagcgagacgtttaggctttaagtctgcc
aatgccgctgaagagcatttaaaagcactggctaaaaaggggtgtattgagatcataccg
ggaacctctagaggtattcggctcactcaagaggaaccggaagaggtcgaactcggctta
cctttaattggtcaagttgctgcaggtgagccgatcctcgcccaagagcatgttgaacaa
cactataaagttgaccctgccatgttccgcccttctgctgattttctactgcgagtccga
ggtgacagtatgaaggatattggcatactcgaaggtgatctattagccgtgcataaaagt
cagcaagcacgtaacggccaagtagtcgttgctcgagtggaagatgacgtaaccgttaag
cgctttgaaaagaaaggtaataaggtctttctacatgctgaaaatgaagaatattcacca
atagaagtagatctagcgaaccagagcttaagcattgaagggctagcagttggcgtgatc
cgcaatggagattggcaatga

DBGET integrated database retrieval system