KEGG   Shewanella piezotolerans WP3: swp_4992Help
Entry
swp_4992          CDS       T00791                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:swp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5214965..5215780
Genome map
AA seq 271 aa AA seqDB search
MPELPEVEVTKQGVSPYLIDNRVTDLIIRNPSLRWPVPDIAKQIIGQTIRAVRRRAKYLL
IDTDAGTTIVHLGMSGSLRILPINSPVEKHDHIDLVLASGKILRYNDPRRFGAWLWNELP
EQAHPLLAKLGPEPLESAFNSSYLLSALANKKKAIKLCLMDNHIVVGVGNIYANEALFAA
GIHPQAEAGKVDAERISILVAEVKQILARAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGR
GGDTCTHCGQLLSEIRLGQRATVFCSICQQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccccgaagtagaagtcaccaagcaaggagtttctccttatttaattgat
aacagggtgacggatttaatcattcgcaacccttcactgcgctggcctgtgcctgatatt
gctaaacagataatcggccaaacgattagagcagtgcgacgccgtgcaaagtacttactg
atagatactgatgctggcacgacaattgtccatcttggcatgtcaggaagtttgcggatc
ttgcctataaacagcccagttgaaaaacatgaccacatcgatttggtactcgctagcgga
aaaatattacgttacaacgatccacgacgttttggtgcatggctctggaacgagctacca
gaacaggctcacccactattagctaagttaggacccgagccgttagaaagcgcattcaac
agcagctatctgttgagcgctttagcaaacaaaaagaaggcgataaaactgtgcttgatg
gacaatcatatcgtagttggggtcggtaatatttatgccaatgaggcgctatttgcagcg
ggtattcacccacaagcagaggcgggtaaggtcgatgctgagcgcattagcatattagtt
gcagaggtaaaacagatccttgcccgagcgattaagcaaggcggcaccaccttgaaagat
ttcaccaacgccgaggggaaaccgggctacttcgcccaaaagctacatgtatatggtcga
ggtggtgatacttgtactcattgcggtcagttactcagtgaaatacgtttaggccagcga
gccactgtattttgtagcatctgccaacagcgttaa

DBGET integrated database retrieval system