KEGG   Shewanella piezotolerans: swp_5060Help
Entry
swp_5060          CDS       T00791                                 

Definition
Sialyltransferase 0160
Orthology
K12248  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 0160) [EC:2.4.99.1]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     swp_5060
Glycosyltransferases [BR:swp01003]
 Terminal extension
  Bacterial sialyltransferase
   swp_5060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5280624..5281727
Genome map
AA seq 367 aa AA seqDB search
MLVNNQSHNPKLICWQRHPVNDEALLQGINAASFVSIASLCQHAATLLAGHPHSHITIYG
NTYWSKDLARLIRYLTRISGVEIKKLELIDDGSSEYQKMFYWQRLSSEEQTRDLATGLKN
LKSYLSGNDNKLLRLLTGHSNKLPRRLSSFMNWHQLFPTTYHMLRMDYLDKPELHQLKQY
LGNNAQQIRWNYIADNLFDDEQQSLFYQLLGISLAEQKQLRAGRQQLHDFMFIGVDSSNA
SSKLQINVIADSRQESGIIPTITAKKMLFKGHPFANFNQTIVDAHQMGEMPAMIPFETLI
MTGNLPQKVGGMASSLYFSLPNNYHIEYIVFSGSKKDLEQHALLQIMLYLKVISPERVYF
SEQFKSC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttaacaatcaaagccacaaccctaagttaatttgctggcaacgacatccagtt
aacgacgaagctttattgcaaggtatcaatgccgcatcctttgttagcatagcttcacta
tgccaacatgcagccacactgttggcaggtcatcctcacagccatatcaccatttacggc
aacacctattggagtaaagatcttgctaggctcattcggtatctgactagaatctcaggg
gttgaaattaaaaaactggaattgattgatgatggctcttcggaataccaaaagatgttt
tattggcaacgtttaagttccgaagagcaaactcgcgatctagctactggactgaaaaac
ctaaaaagttatcttagtggaaatgacaataaactactaaggctactgactggccactca
aacaagctaccaaggcgcctatcaagcttcatgaattggcaccaactctttcccactacc
taccatatgttacgtatggactacttggataaacctgaactccatcaattgaagcaatac
ctgggtaacaatgctcagcaaatccgttggaattatatcgctgacaatttgtttgatgac
gagcagcaatcgcttttctatcaattattagggatctcgttggcggaacagaaacagtta
agagcaggcaggcaacagctgcatgactttatgttcataggtgttgattccagcaatgcg
agcagcaagctgcaaataaatgtaattgcagattctcgtcaagaatcaggaattattcct
acgattacggctaagaagatgttatttaaaggccatccttttgccaattttaatcagaca
attgtagatgcacatcaaatgggcgagatgccagcgatgatcccattcgaaacgcttatc
atgaccggtaatttaccgcaaaaagtggggggaatggcaagttcactctacttttctctg
ccaaacaactatcacattgaatatattgttttttctggctcaaaaaaggatttggaacag
catgcgttactacaaatcatgctttacttgaaagtgataagccctgaaagggtttacttt
tcagagcagtttaaatcctgctag

DBGET integrated database retrieval system