KEGG   Shewanella piezotolerans WP3: swp_5081Help
Entry
swp_5081          CDS       T00791                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:swp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5305704..5306681
Genome map
AA seq 325 aa AA seqDB search
MPNAAEPAPSLSTASSFSSEHHLNSPEQTAFWQQVTQSSFKANDDVSLAYACIINPNSIG
TIVLSSGRVESYLKYKELMFDLYLQGYSLFAIDHRGQGLSSRTTTDPHKGHIDKFQRYVD
DFGDFINKVVKPQPEEDYFLVGHSMGGAIGTLYLEQHSGVFKAAVFSAPMYGIKLPLPKR
FIRWLAARLDNHNKQQPNYVLGGKGYHADEFDKNDLTNSKLRYQDYRKLYEQEPKLQLGS
PTNHWLVESIDAGDDAIKAAQNIDIPLLVLQAEEDTIVSNTAQKKAATGQCKLLKIPYAR
HEIFMERDKARNLALSALLAFLQQT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgccgctgagcccgctccatcattaagcactgcaagttccttttcatcagag
catcacctcaatagcccagaacaaactgcattttggcagcaagtgactcaatcaagtttc
aaagcaaatgatgatgtcagcctggcttatgcctgcatcatcaatccaaatagcatagga
acaattgtactcagtagcggccgagttgagtcctatttgaagtataaagagttgatgttt
gatctgtacctgcaaggttacagtttatttgccattgaccatcgtggacagggcctttcc
agcagaacaaccacagatccacataaaggacatatcgacaaattccagcgttatgtcgac
gattttggcgattttatcaacaaagttgtaaagccacagccagaagaagattactttcta
gtaggacattccatgggaggcgcaattggtactttatacctagagcagcattcaggagtg
tttaaagccgccgttttttctgcacctatgtatggcattaaactacctttgcctaaacgc
tttattcgttggttagcagcacgactcgataatcataacaaacagcaaccaaattatgta
ttgggtggcaaaggttaccatgcagatgagttcgacaagaacgatctcaccaacagtaaa
ctgcgttaccaagattatcgcaaactctatgagcaagagcccaagttacagctaggttcg
ccgactaatcattggctggtagagtcaatcgacgccggcgatgatgccattaaggccgca
cagaatattgatattcccttgctagtattgcaagctgaagaagacactattgtcagtaat
accgctcaaaaaaaagcggctacaggtcaatgcaagctgctcaaaattccctatgctcgc
catgaaatattcatggagcgcgataaggccagaaacctagccctaagcgcactgctggca
tttttacagcaaacttaa

DBGET integrated database retrieval system