KEGG   Shewanella piezotolerans: swp_5081Help
Entry
swp_5081          CDS       T00791                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
swp  Shewanella piezotolerans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    swp_5081
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     swp_5081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5305704..5306681
Genome map
AA seq 325 aa AA seqDB search
MPNAAEPAPSLSTASSFSSEHHLNSPEQTAFWQQVTQSSFKANDDVSLAYACIINPNSIG
TIVLSSGRVESYLKYKELMFDLYLQGYSLFAIDHRGQGLSSRTTTDPHKGHIDKFQRYVD
DFGDFINKVVKPQPEEDYFLVGHSMGGAIGTLYLEQHSGVFKAAVFSAPMYGIKLPLPKR
FIRWLAARLDNHNKQQPNYVLGGKGYHADEFDKNDLTNSKLRYQDYRKLYEQEPKLQLGS
PTNHWLVESIDAGDDAIKAAQNIDIPLLVLQAEEDTIVSNTAQKKAATGQCKLLKIPYAR
HEIFMERDKARNLALSALLAFLQQT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgccgctgagcccgctccatcattaagcactgcaagttccttttcatcagag
catcacctcaatagcccagaacaaactgcattttggcagcaagtgactcaatcaagtttc
aaagcaaatgatgatgtcagcctggcttatgcctgcatcatcaatccaaatagcatagga
acaattgtactcagtagcggccgagttgagtcctatttgaagtataaagagttgatgttt
gatctgtacctgcaaggttacagtttatttgccattgaccatcgtggacagggcctttcc
agcagaacaaccacagatccacataaaggacatatcgacaaattccagcgttatgtcgac
gattttggcgattttatcaacaaagttgtaaagccacagccagaagaagattactttcta
gtaggacattccatgggaggcgcaattggtactttatacctagagcagcattcaggagtg
tttaaagccgccgttttttctgcacctatgtatggcattaaactacctttgcctaaacgc
tttattcgttggttagcagcacgactcgataatcataacaaacagcaaccaaattatgta
ttgggtggcaaaggttaccatgcagatgagttcgacaagaacgatctcaccaacagtaaa
ctgcgttaccaagattatcgcaaactctatgagcaagagcccaagttacagctaggttcg
ccgactaatcattggctggtagagtcaatcgacgccggcgatgatgccattaaggccgca
cagaatattgatattcccttgctagtattgcaagctgaagaagacactattgtcagtaat
accgctcaaaaaaaagcggctacaggtcaatgcaagctgctcaaaattccctatgctcgc
catgaaatattcatggagcgcgataaggccagaaacctagccctaagcgcactgctggca
tttttacagcaaacttaa

DBGET integrated database retrieval system