KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0356Help
Entry
SXYLSMQ121_0356   CDS       T03311                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sxl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SXYLSMQ121_0356
   00630 Glyoxylate and dicarboxylate metabolism
    SXYLSMQ121_0356
   00640 Propanoate metabolism
    SXYLSMQ121_0356
   00650 Butanoate metabolism
    SXYLSMQ121_0356
  Lipid metabolism
   00071 Fatty acid degradation
    SXYLSMQ121_0356
   00072 Synthesis and degradation of ketone bodies
    SXYLSMQ121_0356
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYLSMQ121_0356
   00310 Lysine degradation
    SXYLSMQ121_0356
   00380 Tryptophan metabolism
    SXYLSMQ121_0356
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SXYLSMQ121_0356
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SXYLSMQ121_0356
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SXYLSMQ121_0356
Enzymes [BR:sxl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SXYLSMQ121_0356
Exosome [BR:sxl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SXYLSMQ121_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
426331..427485
Genome map
AA seq 384 aa AA seqDB search
MNKVAIVSAKRTPIGRFRGKLSKYSAVELGTKTLEAAMKAINIDPQKVEQVIYGNVLQSG
SGQNPARQIAIHSGVPNTTPAMTINEVCGSGLKSIILGKQLIQLGEAKVVAVGGVESMTN
APKLVLNEGESPVDSFMHDGLTDAFLNVPMGITAEKIAEKYNVSREAQDYFANESQQKAQ
QATEAGKFNNEIVPLEDVNGEMMTTDEGIRGNSSVEKLSTLKTIFKEDGTVTGGNASSIN
DGASTIILMDADYAKQEGYEILAIVGEHAEIGCDPEYMGYAPYHAVTKLLDKTDKVIDDF
DVVEMTEAFASQSIPVRDNLSISEDKLNLYGGAIALGHPIGASGTRLVTTLVNILAQEEK
QSGIATACIGGGLGIAIQIEKENN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtagcaatcgtaagtgcaaaacgtacaccaataggaagatttagagggaaa
ttaagtaaatattcagcagttgaacttggaacgaagacattagaagctgctatgaaggca
attaacatagatccacagaaagtagagcaagttatctatggtaatgtattacaaagcggt
agtggtcaaaatcctgcccgtcaaatagcaatccattccggtgttccaaatacaacacca
gctatgaccataaatgaagtgtgtggctctggcttaaaatctattattttaggaaagcaa
ttaatccaattaggtgaagctaaagtagtggctgtaggtggtgtggaaagcatgacaaat
gcacctaagttagtgcttaatgaaggtgaatctcctgtagatagctttatgcacgatggt
cttactgacgcttttttaaacgtacctatgggtattacagctgaaaaaattgcagaaaag
tacaacgtatcacgtgaagcacaggattattttgctaacgaatctcaacaaaaagcacaa
caagcgacagaagcaggtaaatttaataatgaaatcgttccattagaagatgtaaatgga
gaaatgatgactacggatgaaggtattcgtggaaatagtagtgttgagaaattaagtaca
ttaaaaacaatatttaaagaagacggcacggtaacaggcggcaacgcgtctagtattaat
gatggtgcgtctacaattattttaatggatgctgactatgcgaaacaagaaggctatgaa
attttagctatagttggagagcatgccgaaattggttgtgatccggagtatatgggctat
gcaccatatcatgcagtgacaaaattattagataagacagataaggtcatcgatgacttt
gatgtagtagaaatgacggaagcttttgcgtcacaaagtattcctgtgagagacaattta
agtatatctgaagataagctgaatttatatggtggtgcgattgcgttaggtcaccctata
ggcgcaagtggtacacgcttagttacaactttagttaatattttagctcaagaagagaaa
caatcaggtatagcaactgcttgtatcggtggcggtttaggaattgcaatccaaattgaa
aaggagaataactaa

DBGET integrated database retrieval system