KEGG   Staphylococcus xylosus C2a: SXYL_02274Help
Entry
SXYL_02274        CDS       T03742                                 

Gene name
vraB
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sxo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SXYL_02274 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SXYL_02274 (vraB)
   00640 Propanoate metabolism
    SXYL_02274 (vraB)
   00650 Butanoate metabolism
    SXYL_02274 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    SXYL_02274 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SXYL_02274 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYL_02274 (vraB)
   00310 Lysine degradation
    SXYL_02274 (vraB)
   00380 Tryptophan metabolism
    SXYL_02274 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SXYL_02274 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SXYL_02274 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SXYL_02274 (vraB)
Enzymes [BR:sxo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SXYL_02274 (vraB)
Exosome [BR:sxo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SXYL_02274 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
Chr1:complement(2318453..2319595)
Genome map
AA seq 380 aa AA seqDB search
MNEAVIVAAKRTPFGKYGGKLKHLEPEALLKPLFEHFNAQYVDIMTEIDDVILGNVIGNG
GNIARKALLEAGLNQNIPGLTLDRQCGSGLEAVIHACRMVQAGAGSIYIAGGVESTSRAP
WKIKRPQSVYDTQLPEFFERASFAPDSQDPSMIQAAENVAQRYNISRNDQDAFAFESHRK
TIMAYKQKQLNQEIISLEVKGKFFNRDESIKERMDERTLNRLKPLLTEGTVTAGNCCMKN
DGAVLLLVMNKAMAEAYGIQEGLTFKDGITVGVDPTLLGIGPVPAINTLLKRNKHTIDEL
DAIELNEAFASQVLASQRELGISLNKLNIYGGAIASGHPYGASGAALVTRLFYMKDYYRT
IATMGIGGGMGNGAIFERWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcggttatagtcgcagcgaaacgaacaccatttggtaaatatggtggaaaa
ttaaagcatttagaaccagaagcattattaaaaccgttatttgagcattttaatgcacaa
tatgtagacataatgacagaaattgatgatgtgattttaggtaatgtaataggaaatggt
ggcaatattgctaggaaagctttgctagaagctggattgaatcaaaatattcctggacta
acattagataggcaatgtggttctgggttagaagcagtgatacacgcatgtcgaatggtg
caagcaggtgcggggtccatatatattgctggtggcgttgaaagtacaagtagagcgcca
tggaagattaaaagaccgcaatccgtatatgacacacagttacctgaattttttgaacgt
gcttcttttgcaccagatagccaagatccatcgatgatacaagctgcagaaaatgtagct
caaagatataatatatcaagaaatgatcaggatgcgtttgcatttgaaagtcatagaaag
acgattatggcttataaacaaaagcaacttaatcaggaaattatttcgttagaagtgaag
gggaaattttttaacagagacgaaagtattaaagaaagaatggatgaacgcacattaaat
cgtttgaaaccattgttaactgaaggaacagtcactgcagggaattgttgtatgaagaac
gatggcgcagtattattattagttatgaataaagcaatggctgaagcttatggtatacaa
gagggtttaacttttaaagatggtattacagtgggagttgatcctactttacttggaatt
ggaccagtacctgcaataaacacattacttaagagaaataaacatacaatagatgaatta
gacgctatagaattaaacgaagcatttgcatctcaagtattagcaagtcaaagagagtta
ggtatatcactaaataagttgaatatatatggtggggcaattgcttcagggcatccatat
ggtgcaagtggtgcggcattagttacacgcttgttttatatgaaggattactatagaact
attgcaactatggggattggaggtggcatgggaaatggagcgatatttgaaagatggtca
tga

DBGET integrated database retrieval system