KEGG   Synechococcus elongatus PCC6301: syc0155_dHelp
Entry
syc0155_d         CDS       T00163                                 

Definition
endo-1-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
syc  Synechococcus elongatus PCC6301
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
168423..169544
Genome map
AA seq 373 aa AA seqDB search
MIGHTLRRRQFLQGLCGASAVLLAQQVQAAPARLRSLAELAQQRSLLRGSAITTDMLAIP
DLAALYRQQTSLLVPEWEMKWEVLQPSPDRFDFSRSDRLLAFAQSYQAQLRGHTLLWHQQ
LPQWLASLTAAETATALQRYITTVVGHYRGHLQSWDVINEPIAENGQGLRPNLWLRQLGP
SYLEKSLRWARAVDPTVPLVINDFGLEPDSPLATRKRLQLLRLVQELRDRDTPLQAIGFQ
AHLVANPQAPPSFTGFAEFLADLSRFDLDFYITELDVNDQALPANNAERDREVAQTYQRF
LSAVLPLPRLKLVTTWGLSDRFTWLNQFAPRADGLPQRPLPFDSVFQPTETYGNLITLLQ
SVSNGPNSSTSTQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgattggtcatacgctgaggagacgccagtttttgcagggactttgtggtgcgtctgca
gttctactcgcccagcaagtccaagctgcaccggcaagattgcgatcgctggcagagtta
gcacaacagcgatcgctcctgcggggatctgccattacgactgacatgttggccattcca
gacttagcagcactctatcgtcagcaaacgagtctcttggtgccggaatgggaaatgaag
tgggaggtgttgcaaccgagccccgatcgctttgactttagccgctcggatcgcttactc
gcttttgcgcagtcctatcaagcccagttgcgcggtcacacgttgctctggcatcagcaa
ttgccgcagtggctagcatccttgacagcggctgagacagcaacagccctgcaacgctat
atcaccaccgttgttggtcactatcgcggtcacctgcaatcttgggatgtgattaacgaa
ccgatcgccgaaaatggacaaggactccgtcccaatctttggttacggcagctagggcct
agttatttagagaagagcctgcgctgggcaagagcggtcgacccgacagttcccttggtc
attaatgacttcggtctggaacctgatagccccctcgcgactcgtaaacgtctgcagcta
ctgcgtctcgttcaggaattgcgcgatcgcgatactccccttcaggcgatcgggttccaa
gctcacttggtcgctaacccccaagcacctcccagcttcactggttttgctgagttttta
gcggacttgagtcgctttgatctcgacttctacattacagaattagacgtcaatgatcag
gctttaccggccaataatgctgagcgcgatcgcgaagttgcccagacctatcagcgtttc
ttgagtgcagttctaccgcttcctcgcctcaagttagtgaccacttgggggctcagcgat
cgcttcacttggcttaatcagtttgcacctcgggcagatggactacctcagcgtccactc
ccgtttgattccgtttttcaacccactgagacctatggcaacctcatcaccctcctccaa
tcagtttcaaacggacccaacagcagcacctcaacgcagtag

DBGET integrated database retrieval system