KEGG   Synechococcus elongatus PCC6301: syc0230_cHelp
Entry
syc0230_c         CDS       T00163                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:syc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(268003..268722)
Genome map
AA seq 239 aa AA seqDB search
MALQQTQIQEWRRRGKYLLADLSREGEPAGTWGVHLRMTGQFFWTEPATPLTKHTRVRLR
FEGDRELRFIDIRSFGQMWWVPPDRPVESVITGLSKLGPEPFAPEFTARYLRDRLRRSQR
PIKTALLDQSLVAGIGNIYADESLFRTGIHPTTPSDRLTKIQAEKLREAIVEVLTASIGA
GGTTFSDFRDLTGVNGNYGGQAWVYGRKDQPCRTCGTPIQKLKLAGRSSHFCPRCQPCS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgcagcagacccaaattcaggaatggcgacgccgtggcaaatatttgttagct
gacctcagtcgtgagggagagcctgcaggaacttggggcgtgcatctgcggatgacaggg
cagtttttctggacagagccggcaacgccgctgaccaaacatacgcgggtgcggctgcgg
tttgagggcgatcgcgagttgcgatttattgatatccgcagctttggccagatgtggtgg
gtaccgcccgatcgccctgtggaatccgtgattacgggcttgagcaaactggggccagaa
ccgtttgcaccggaattcaccgcccgctatctgcgcgatcgcctgcggcggagccaacgc
cccatcaaaacggcgctcctcgatcagtccttggtggcgggtattggcaacatttatgcc
gatgaaagtttgtttcgcaccggtattcatccgaccacaccaagcgatcgcctaaccaag
atccaggcggaaaaactgcgggaagcgatcgttgaggtcctcacggccagtatcggagca
ggcggcacgacctttagtgacttccgcgatctaacgggtgtgaacggtaactatggcggt
caagcgtgggtctatggccgcaaggatcaaccttgtcgcacttgcgggactccgattcaa
aaactcaaactggctgggcgatcgagtcacttttgtcctcgctgtcagccctgttcctag

DBGET integrated database retrieval system