KEGG   Synechococcus elongatus PCC6301: syc0290_dHelp
Entry
syc0290_d         CDS       T00163                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    syc0290_d (tpiA)
   01230 Biosynthesis of amino acids
    syc0290_d (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0290_d (tpiA)
   00051 Fructose and mannose metabolism
    syc0290_d (tpiA)
   00562 Inositol phosphate metabolism
    syc0290_d (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc0290_d (tpiA)
Enzymes [BR:syc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     syc0290_d (tpiA)
Exosome [BR:syc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   syc0290_d (tpiA)
  Exosomal proteins of bladder cancer cells
   syc0290_d (tpiA)
  Exosomal proteins of melanoma cells
   syc0290_d (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
335820..336581
Genome map
AA seq 253 aa AA seqDB search
MNGLARSEQSAVRRIIIAGNWKMYKTQAEALEFLQAFLPQLSETPESRKVVLCAPFTTLS
SLSKTLHGSRVRVGAQNIHWAKEGAFTGEISGAMLTEIGVRYVVVGHSERRQYFGETDET
VNQRLLAAQSFGLLPILCVGESKQQRDAGETEAVISRQLERGLVGADQTNLVIAYEPIWA
IGTGDTCAAEEANRVIGLIRSQLKDTDVPIQYGGSVKPENIDEIMAQPEIDGALVGGASL
EAESFARIVNYQS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtcttgcaaggagcgaacagtcagccgtgcgtcggatcatcattgccgggaac
tggaaaatgtacaaaacccaggccgaagccctggagttcttgcaagcctttttgccacag
ctcagcgaaacgccagaatcgcgcaaagttgtgctctgtgcacccttcacgaccctgtct
agcctgagcaaaaccctccacggcagccgggtgcgcgtgggtgctcaaaacattcactgg
gccaaggaaggggctttcactggcgaaatctcgggagcaatgctgacggagattggcgtt
cgctatgtagtggttggtcacagtgagcgccgtcagtacttcggggaaacagatgaaacc
gtcaaccagcgcttgctggcagcccaatccttcggtctgttaccgattctctgcgtgggt
gagtcgaagcaacagcgcgatgctggtgagactgaagccgtgatcagtcgtcagttggag
cgtgggttggtcggtgccgatcaaaccaacttggtgattgcctacgaaccgatctgggcg
atcgggactggtgatacctgtgcagccgaggaagctaatcgcgtcattggcctgattcgc
agtcagctcaaggatactgatgtgccgatccagtacggtggttcggtcaaacctgagaac
atcgacgagatcatggcgcagccagaaattgatggagccttggtcggcggtgctagcctc
gaagctgagagtttcgcccgcatcgtcaattaccagagctaa

DBGET integrated database retrieval system