KEGG   Synechococcus elongatus PCC6301: syc0353_dHelp
Entry
syc0353_d         CDS       T00163                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01130  Biosynthesis of antibiotics
syc01230  Biosynthesis of amino acids
Module
syc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    syc0353_d (trpC)
Enzymes [BR:syc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     syc0353_d (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: BAD78543
CyanoBase: syc0353_d
CYORF: syc0353_d
UniProt: Q5N575
Position
395077..395964
Genome map
AA seq 295 aa AA seqDB search
MEVRRRPPNPAVHVASLTYQVKVPGSSPSNILEEIVWYKEREVNAWREQLPLQQLQNQVR
GLTQTPRDFLAALRQAPTRPAVIAEVKKASPSKGVLREDFDPVAIAQAYAANGAACISVL
TDEKFFQGGFENLQRVRAAVDVPLLCKDFVIYPYQIYKARLLGADAVLLIAAILSDADLR
YFLKIAHSLGLNALVEVHSLPELERVLALDDLRLVGINNRNLKTFVTDLAVTEHLAAQCR
DRDLLLVSESGLFTGADLDRVTQAGAQAVLIGESLVKQPDPGLALQQLVGDRPSA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccgccgccgtccccccaatccagctgtgcatgttgccagcctcacctatcag
gtcaaggtgccggggagcagccccagcaacatcctcgaagagattgtttggtataaggag
cgcgaggtgaatgcttggcgagagcagctgccgctgcagcagctccagaaccaagtccgc
ggcttgacccaaacgccccgtgactttttggcagcactgcgacaggcaccgactcgaccg
gccgtgattgccgaagtcaaaaaagcatctcctagcaaaggcgtactgcgagaagatttc
gatcccgtggcgatcgcccaagcctatgcggctaatggggcggcttgcatttcggtgctg
accgacgagaagtttttccaaggcggcttcgaaaatctacagcgggtgcgagcagcagtc
gatgtaccgctgctctgcaaagactttgtgatctacccctatcagatctacaaagcccgc
ttactgggggccgatgccgtgctgttgatcgcggcgattctttcggatgctgacctgcgc
tacttcctgaagatcgcccacagtctgggactcaatgcgctggtggaagtgcatagcctg
ccggaacttgagcgtgtccttgccttggatgatctgcggctggttggcattaacaaccgc
aacctcaagacttttgtgaccgatctggcggtgacagagcatcttgctgcccaatgccgc
gatcgcgatttgctcttggtcagtgaatcgggtttgttcaccggcgccgatctcgatcgc
gttacccaagctggcgcacaggccgtcttgatcggtgaatcgctggtcaagcaaccggat
ccaggcttggcactgcagcagttagttggcgatcgcccctcagcctaa

DBGET integrated database retrieval system