KEGG   Synechococcus elongatus PCC6301: syc0359_cHelp
Entry
syc0359_c         CDS       T00163                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00230  Purine metabolism
syc01100  Metabolic pathways
Module
syc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    syc0359_c
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     syc0359_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase ABC_tran AAA_22 AAA_18 AAA_29 MMR_HSR1 AAA AAA_28 AAA_17 AAA_14 dNK AAA_30 CPT cobW NACHT NTPase_1 ATPase_2 TsaE AAA_21 AAA_23 RNA_helicase NB-ARC
Motif
Other DBs
NCBI-ProteinID: BAD78549
CyanoBase: syc0359_c
CYORF: syc0359_c
UniProt: Q5N570
Position
complement(399905..400456)
Genome map
AA seq 183 aa AA seqDB search
MSIGRVVVLTGPSGVGKGTLLKAILSQHPEAFLSISATTRSPRPGEVDGQHYYFLSREEF
QTKIAEQEFLEWAEFAGNLYGTPRSPVIEQVNLGRTVILEIELEGARQVRKTLPSARQVV
LLPPSVEELEQRIRERATEDEAAIARRLLQAQTEIGAAKEFDRCVINDQLDTAITALEAA
IFS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtattggtcgtgtggtggtgttaacgggacctagtggtgtgggcaaaggcacgctc
ttgaaagcgatcttgtctcagcatcccgaggcctttctttccatctccgccaccacgcga
tcgccccgtccgggcgaagtcgacggtcagcattactacttcctcagtcgcgaggaattt
cagaccaaaattgctgaacaagaatttttagagtgggctgaatttgctggcaacctctac
ggcacaccgcgatcgccggtgattgagcaggtcaacctggggcgcaccgtcatcctcgaa
attgagctagaaggggctcgccaagtcaggaaaacgctcccctcagctcggcaggtggtg
ttgctgccacccagtgttgaggagctggagcaacggattcgggagcgtgccacggaagat
gaagccgcgatcgctcgccgcctcttacaggctcaaacggaaatcggtgcggccaaagag
tttgatcgctgcgtaatcaatgaccaactagacaccgcgatcaccgccctagaagcggcc
atttttagttag

DBGET integrated database retrieval system