KEGG   Synechococcus elongatus PCC6301: syc0359_cHelp
Entry
syc0359_c         CDS       T00163                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:syc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(399905..400456)
Genome map
AA seq 183 aa AA seqDB search
MSIGRVVVLTGPSGVGKGTLLKAILSQHPEAFLSISATTRSPRPGEVDGQHYYFLSREEF
QTKIAEQEFLEWAEFAGNLYGTPRSPVIEQVNLGRTVILEIELEGARQVRKTLPSARQVV
LLPPSVEELEQRIRERATEDEAAIARRLLQAQTEIGAAKEFDRCVINDQLDTAITALEAA
IFS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtattggtcgtgtggtggtgttaacgggacctagtggtgtgggcaaaggcacgctc
ttgaaagcgatcttgtctcagcatcccgaggcctttctttccatctccgccaccacgcga
tcgccccgtccgggcgaagtcgacggtcagcattactacttcctcagtcgcgaggaattt
cagaccaaaattgctgaacaagaatttttagagtgggctgaatttgctggcaacctctac
ggcacaccgcgatcgccggtgattgagcaggtcaacctggggcgcaccgtcatcctcgaa
attgagctagaaggggctcgccaagtcaggaaaacgctcccctcagctcggcaggtggtg
ttgctgccacccagtgttgaggagctggagcaacggattcgggagcgtgccacggaagat
gaagccgcgatcgctcgccgcctcttacaggctcaaacggaaatcggtgcggccaaagag
tttgatcgctgcgtaatcaatgaccaactagacaccgcgatcaccgccctagaagcggcc
atttttagttag

DBGET integrated database retrieval system