KEGG   Synechococcus elongatus PCC6301: syc0527_cHelp
Entry
syc0527_c         CDS       T00163                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    syc0527_c
Enzymes [BR:syc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     syc0527_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(586006..587505)
Genome map
AA seq 499 aa AA seqDB search
MFTRAAGILLHPTSLPGPFGSGDLGPASRQFLDWLATAGQQLWQVLPLGPTGYGYSPYLC
YSALAGNPALISPELLAEDGWLQESDWADCPAFPSDRVDFASVLPYRDQLLRRAYSQFLQ
RAASSDRQLFQAFCEQEAHWLDDYALFMAIKLASQGQPWTEWPEALRQRQPQALAKARDR
WGGEIGFQQFLQWQFREQWLALREEAQARHISLIGDIPIYVAHDSADVWANPQFFALDPE
TGAVDQQAGVPPDYFSETGQLWGNPVYNWAALQADGYRWWLQRLQQLLSLVDYIRIDHFR
GLEAFWSVPAGEETAIDGEWVKAPGADLLSTIRQKLGALPILAEDLGVITPEVEALRDRF
ELPGMKILQFAFDSGAGNAYLPHNYWGRRWVAYTGTHDNDTTVGWFLSRNDSDRQTVLDY
LGAESGWEIEWKLIRLAWSSTADWAIAPLQDVFGLDSSARMNRPGQATGNWDWRFSADWL
TGDRAQRLRRLSQLYGRCR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacacgagccgccggcattttgttacatcccacttcgttgccggggccattcggc
agcggcgaccttggtccggcctcgcggcagtttcttgactggttggcaacggcgggacaa
caactgtggcaagtgttgccccttgggccgacaggctatggctattcgccttacctctgc
tattccgccttggctggcaatcccgctctgatcagccctgaactcttggcagaagatggc
tggctccaagaatcggactgggcagactgtcctgcttttccgagcgatcgcgtcgatttt
gccagcgtcttgccctatcgcgatcaactgctgcgccgtgcctacagccaattcctgcaa
agagcggcttccagcgatcgccaactctttcaagctttctgtgaacaggaagcccattgg
ctggatgactacgccctgttcatggcgattaagctggctagccaaggtcagccttggaca
gaatggccggaagcgctgcgtcagcggcaacctcaagccttggctaaagcccgcgatcgc
tggggcggcgaaattggcttccagcagtttctgcagtggcaatttcgcgagcagtggttg
gccctgcgggaagaagcccaagcccgccatatttcgctgattggcgatattccgatctac
gtcgctcatgacagtgcggacgtttgggccaatcctcagttctttgccctcgatcctgaa
acgggcgcagttgatcagcaggccggtgtgccgcctgactatttctccgaaaccggccaa
ctctggggcaatcccgtctacaactgggctgcgctgcaggcggatggctatcgctggtgg
ttgcaacggctgcaacagctcctcagcttagtggactacattcgcatcgaccacttccgc
ggtttagaggcgttttggtcggttcccgctggtgaagaaacggcgatcgacggagagtgg
gtcaaagccccaggcgctgatctgctgagcacgattcgccaaaaactgggagcgctaccg
attctggcagaggatctcggtgtgattacgccggaggtggaagcgctgcgcgatcgcttt
gagctgccgggcatgaagattctgcagttcgcctttgactctggggccggcaatgcctat
ctaccgcacaactactggggtcgtcgctgggtggcttacaccggcacccacgacaatgac
acgaccgtcggctggttcctgtcccgcaatgacagcgatcgccaaacggtgctggattat
ctgggcgcagagtcgggctgggaaattgagtggaagctgatccgcttggcttggagctcg
acggcagattgggcgatcgcaccgctccaagatgtcttcgggctggatagcagcgcccgc
atgaatcgaccggggcaagccaccggcaactgggactggcgcttcagtgccgactggctg
acgggcgatcgtgcccaacgcctgcggcgactctcgcagctctatggacgctgtagatga

DBGET integrated database retrieval system