KEGG   Synechococcus elongatus PCC6301: syc0694_dHelp
Entry
syc0694_d         CDS       T00163                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0694_d
Enzymes [BR:syc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     syc0694_d
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
779786..780604
Genome map
AA seq 272 aa AA seqDB search
MMEDTFTPLQLQVEGASLRFCRYGGQVLSWQPADGQERLFLSDRSLYQSGQAIRGGVPII
FPQFSGRGSLPKHGFARDRAWALLQWDEDSGQAELELRESLETLQIWPFAFRLVLKLQLR
PQQLQLQLTVENCDRQPWSFTAALHSYLAVPDLATVHLQGLQGRWGTEQTTGDRWQEMEC
DRHFPQAIDALYEAPAQPLTLLAPPWSALQICQTGFTETVIWNPGSAGVSQIGDLASGSE
QQFLCVEAAVVQSPPRLEPGEIWQGQQVFQVG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagatacgtttacgccgttacagctccaggttgaaggggcgagcctgcggttc
tgtcgctacggtgggcaagtattgtcctggcaacccgccgatggtcaagagcgcctattc
ctgagcgatcgcagtctttaccagtccggtcaggcgattcgcggtggcgtcccgatcatc
tttccccagttctcggggcgcgggtcattgcctaagcatggttttgcccgcgatcgcgct
tgggctttgctgcagtgggatgaggacagcggccaagccgagttagagctccgagagtca
ctagaaaccttacagatttggccgtttgcttttcggttggtgctcaagctgcaactccga
ccccagcaactgcagctgcaactcactgttgagaactgcgatcgccaaccttggtcgttt
acagcagcactgcacagctatctagcggtgccggatctggccactgtgcatctacaagga
ctgcaagggcgttggggcacggaacaaaccacgggcgatcgctggcaggagatggagtgc
gatcgccacttccctcaagcgatcgatgcgctctacgaggctccggcgcagcccttgacc
ttgctggctcctccttggtcagcccttcagatctgtcagacagggtttaccgaaacagtg
atctggaacccggggtcagcaggggtcagtcagattggcgatctggcctccggctcagaa
cagcagtttctctgtgtggaagcagctgtcgtgcagtctcctccccgccttgaacctggg
gaaatttggcaggggcaacaagtctttcaggtcggttga

DBGET integrated database retrieval system