KEGG   Synechococcus elongatus PCC6301: syc0834_dHelp
Entry
syc0834_d         CDS       T00163                                 

Gene name
psbT
Definition
(GenBank) photosystem II PsbT protein
  KO
K02718  
photosystem II PsbT protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    syc0834_d (psbT)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc0834_d (psbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
931725..931820
Genome map
AA seq 31 aa AA seqDB search
MESLVYIFVFVVALGVLFFAIAFREPPRIGK
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtctcgtctacatcttcgttttcgttgtggcactgggtgtgctgttcttcgcg
atcgccttccgcgaaccacctcgaatcggcaaataa

DBGET integrated database retrieval system