KEGG   Synechococcus elongatus PCC6301: syc0931_dHelp
Entry
syc0931_d         CDS       T00163                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    syc0931_d (pfkA)
   01230 Biosynthesis of amino acids
    syc0931_d (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0931_d (pfkA)
   00030 Pentose phosphate pathway
    syc0931_d (pfkA)
   00051 Fructose and mannose metabolism
    syc0931_d (pfkA)
   00052 Galactose metabolism
    syc0931_d (pfkA)
  Energy metabolism
   00680 Methane metabolism
    syc0931_d (pfkA)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     syc0931_d (pfkA)
Protein phosphatases and associated proteins [BR:syc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     syc0931_d (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1040485..1041567
Genome map
AA seq 360 aa AA seqDB search
MAVRKLGVLTSGGDCPGLNAVIRAIARHAVGNYGWELWGIAYATQGLLKRQAIALSPHHF
DRQSLDPLLCSGGTILGSINRGDTLAHQAEILAGYQELGLDALIGIGGDGSLAILRQLAE
AGRWQFIGIPKTIDNDVALTERAIGFDTAIHTVAEALLSLGSTAASHDRIMIAEVMGRQS
GHLALQGGIAGGADVILLPEIPYRLLELCHYLQQLRDRWQRRYAVIAIAEGTHHPPEVTQ
GPGSLGEQLVQAITAQDPTLDARVTVLGHVQRGGNPVASDRLLATQMGYAAVERLAAGAS
GEMMAWQGGRVVSVPLEAVCLQSPTLVDPHSPPVDTAAGLGIFLGDRSLTPWRGSACPTH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcgcaagttaggcgttctcaccagtggcggcgattgcccaggcctcaatgct
gtgattcgagcgatcgcccgtcatgccgttggcaattacggctgggagctctgggggatt
gcctacgccactcaagggctcctcaagcggcaagcgatcgccctgtccccccaccacttc
gatcggcagagtcttgacccgttgctctgcagcggtggcaccatcctcgggtccatcaat
cggggcgatacccttgcccaccaagccgaaattctggctggctatcaggaacttggcttg
gatgccctgattggcattggcggcgatggcagtctggccattctgcggcagctagccgaa
gcgggtcgttggcagttcatcggcatcccaaaaaccatcgacaacgatgtagcgctgact
gagcgggcgatcgggtttgataccgccattcacaccgttgcggaagccctgctgagtttg
ggcagcacagcagccagccacgatcgcatcatgattgccgaggttatgggtcgccagtcg
gggcatttggccctacagggcggcattgccggaggcgccgacgtcattctcttgccagaa
attccctatcgactgctggagctctgtcactacttacagcaactgcgcgatcgctggcag
cgtcgctatgccgtgattgcgatcgcggaaggcacccatcatccccccgaggtcactcaa
ggacctggcagcttgggcgaacaattggttcaggcaatcaccgcccaggatccgacatta
gatgcccgtgtcaccgtcttgggtcatgtgcagcgcggtggtaaccccgtagcgagcgat
cgccttttggctactcagatgggctacgccgctgtagaacggcttgccgcaggtgcctcc
ggcgaaatgatggcttggcagggcgggcgggttgtcagcgttccgctcgaagccgtctgc
ctccaaagccctaccttggttgatcctcacagtccgcccgtcgataccgctgcagggctg
ggaatttttctgggcgatcgcagtctgactccttggcggggttcagcgtgccccacccat
tga

DBGET integrated database retrieval system