KEGG   Synechococcus elongatus PCC6301: syc0931_dHelp
Entry
syc0931_d         CDS       T00163                                 

Gene name
pfkA
Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00030  Pentose phosphate pathway
syc00051  Fructose and mannose metabolism
syc00052  Galactose metabolism
syc00680  Methane metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0931_d (pfkA)
   00030 Pentose phosphate pathway
    syc0931_d (pfkA)
   00051 Fructose and mannose metabolism
    syc0931_d (pfkA)
   00052 Galactose metabolism
    syc0931_d (pfkA)
  Energy metabolism
   00680 Methane metabolism
    syc0931_d (pfkA)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     syc0931_d (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     syc0931_d (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Phage_Integr_2
Motif
Other DBs
NCBI-ProteinID: BAD79121
CyanoBase: syc0931_d
CYORF: syc0931_d
UniProt: A0A0H3K7T5
Position
1040485..1041567
Genome map
AA seq 360 aa AA seqDB search
MAVRKLGVLTSGGDCPGLNAVIRAIARHAVGNYGWELWGIAYATQGLLKRQAIALSPHHF
DRQSLDPLLCSGGTILGSINRGDTLAHQAEILAGYQELGLDALIGIGGDGSLAILRQLAE
AGRWQFIGIPKTIDNDVALTERAIGFDTAIHTVAEALLSLGSTAASHDRIMIAEVMGRQS
GHLALQGGIAGGADVILLPEIPYRLLELCHYLQQLRDRWQRRYAVIAIAEGTHHPPEVTQ
GPGSLGEQLVQAITAQDPTLDARVTVLGHVQRGGNPVASDRLLATQMGYAAVERLAAGAS
GEMMAWQGGRVVSVPLEAVCLQSPTLVDPHSPPVDTAAGLGIFLGDRSLTPWRGSACPTH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcgcaagttaggcgttctcaccagtggcggcgattgcccaggcctcaatgct
gtgattcgagcgatcgcccgtcatgccgttggcaattacggctgggagctctgggggatt
gcctacgccactcaagggctcctcaagcggcaagcgatcgccctgtccccccaccacttc
gatcggcagagtcttgacccgttgctctgcagcggtggcaccatcctcgggtccatcaat
cggggcgatacccttgcccaccaagccgaaattctggctggctatcaggaacttggcttg
gatgccctgattggcattggcggcgatggcagtctggccattctgcggcagctagccgaa
gcgggtcgttggcagttcatcggcatcccaaaaaccatcgacaacgatgtagcgctgact
gagcgggcgatcgggtttgataccgccattcacaccgttgcggaagccctgctgagtttg
ggcagcacagcagccagccacgatcgcatcatgattgccgaggttatgggtcgccagtcg
gggcatttggccctacagggcggcattgccggaggcgccgacgtcattctcttgccagaa
attccctatcgactgctggagctctgtcactacttacagcaactgcgcgatcgctggcag
cgtcgctatgccgtgattgcgatcgcggaaggcacccatcatccccccgaggtcactcaa
ggacctggcagcttgggcgaacaattggttcaggcaatcaccgcccaggatccgacatta
gatgcccgtgtcaccgtcttgggtcatgtgcagcgcggtggtaaccccgtagcgagcgat
cgccttttggctactcagatgggctacgccgctgtagaacggcttgccgcaggtgcctcc
ggcgaaatgatggcttggcagggcgggcgggttgtcagcgttccgctcgaagccgtctgc
ctccaaagccctaccttggttgatcctcacagtccgcccgtcgataccgctgcagggctg
ggaatttttctgggcgatcgcagtctgactccttggcggggttcagcgtgccccacccat
tga

DBGET integrated database retrieval system