KEGG   Synechococcus elongatus PCC6301: syc1106_dHelp
Entry
syc1106_d         CDS       T00163                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    syc1106_d (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    syc1106_d (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    syc1106_d (trpA)
Enzymes [BR:syc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     syc1106_d (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1217889..1218689
Genome map
AA seq 266 aa AA seqDB search
MTAISDCFAALRSQGRCALIPFLTAGDPDLETTRQALLALDREGADLIELGVPYSDPLAD
GPVIQAAATRALQAGTRLDDVLALLKDVRSQIKAPIVLFTYCNPILNRGFEAFLDQIAAA
GANGLVVPDLPLEESQRLSEVAAERGIDLILLIAPTSSADRIAAISKQARGFIYLVSVTG
VTGMRQGMQSRVADLLQEIRQGTDKPIGVGFGISGAEQARQVRDWGADGVIVGSAFVNRL
QEQGVEGVATLCRELRQAIDRQPVLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatttctgactgctttgccgccctgcgatcgcagggacgctgtgcattgatc
ccgtttttgacggcgggcgacccggatttagaaaccacccgtcaggcattgctggccctc
gatcgggaaggtgctgacctgatcgagttgggtgtgccctactctgatccgctggctgac
gggcccgtgattcaagcagcagcaacgcgtgccctgcaagcggggacgcgactggatgat
gtcttggcactgctcaaggacgtgcgatcgcagatcaaagcgccgattgtgctgtttacc
tattgcaacccaattctgaaccgcggcttcgaagccttcttggatcagatcgcggcagct
ggcgcgaatggtttggttgtacccgatctgcccttggaagagtcccaacgtctctcagaa
gtcgcagctgagcgtggcattgatttgattctgctgattgcaccgacgagttccgctgat
cgcattgcagcgattagtaagcaggctcgtggctttatctaccttgtcagcgtcaccggt
gtcactgggatgcgccaagggatgcagtcccgtgttgcggatctcctgcaagaaattcgc
caagggactgataagccgatcggggttggcttcgggatttcgggagcagagcaagctcga
caagtgcgcgattggggcgccgatggtgtgatcgttggcagcgccttcgtgaatcgcctg
caagagcagggcgtggaaggggtggccacactctgtcgggaactacggcaggcgatcgat
cgccaacccgtcctgtcctaa

DBGET integrated database retrieval system