KEGG   Synechococcus elongatus PCC6301: syc1203_dHelp
Entry
syc1203_d         CDS       T00163                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    syc1203_d (ispE)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     syc1203_d (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1310465..1311409
Genome map
AA seq 314 aa AA seqDB search
MKTLTLVAPAKINFYLEILGDRPDGFHELAMVMQSIALGDRLHLRQRQGQGFQLGCDRAD
LEVDERNLILKAAQRLQRSFPQIGGVDFFLEKRIPIGAGLAGGSTDGAAALVGLDIFSGL
GLTQPELEAIAAELGSDMPFCVAGGTQLCTSRGEQLTPLPPLPSLSLVLAKFESLSVSTP
WAYGRYREQFGDRYLQTEPARRDRLQALHAGPLLQAMSAGDPVAIAQHLRNDLEAVVLPE
YPQVAELRSVLGNCSGILAAQMSGSGPSVFGIAENPTAAQAAVEQVRQAIADPDLKLWVT
QTISHGIQTETLLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgacgctcgttgctccagccaaaatcaatttctatctggaaattctgggc
gatcgccccgacggtttccacgagctggctatggtgatgcagagcattgccttgggggat
cgtcttcacctacggcagcggcagggacaggggtttcagttgggctgcgatcgcgctgat
ttggaagttgatgagcgcaacttgattctgaaagcagcacagcggttgcagcgatcgttc
ccccaaattggcggcgttgacttttttctcgagaagcggattcccattggtgcagggcta
gcgggcggttcaaccgacggagctgccgctctcgtggggctggatattttcagtgggctg
ggtctgacacaaccagaactggaagcgatcgccgcagaattagggtccgatatgcccttc
tgtgttgccggtggtacccagctttgcaccagtcgcggtgaacaactgacgccgttaccc
cccctaccctctttatccttagtccttgctaagttcgaaagcttgtcggtctcgacgccg
tgggcttacggtcgctaccgcgagcagtttggcgatcgctatctacaaaccgaaccagcg
cggcgcgatcgcctgcaagcgctgcatgccgggccacttctgcaagcgatgagcgctggt
gatcccgttgcgatcgcgcaacatcttcgcaacgatctcgaagcggtggtcttacccgag
tacccccaggtggcggaactgagatctgtgctcgggaactgctctggcattcttgccgcc
caaatgtccggttccgggccaagcgtctttggtattgctgagaatcctactgctgcccaa
gcggccgttgaacaagtccggcaagcgatcgctgatcccgacctgaagctctgggtgacc
caaaccatcagccatgggatccagacggaaactctactgcggtag

DBGET integrated database retrieval system