KEGG   Synechococcus elongatus PCC6301: syc1203_dHelp
Entry
syc1203_d         CDS       T00163                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1310465..1311409
Genome map
AA seq 314 aa AA seqDB search
MKTLTLVAPAKINFYLEILGDRPDGFHELAMVMQSIALGDRLHLRQRQGQGFQLGCDRAD
LEVDERNLILKAAQRLQRSFPQIGGVDFFLEKRIPIGAGLAGGSTDGAAALVGLDIFSGL
GLTQPELEAIAAELGSDMPFCVAGGTQLCTSRGEQLTPLPPLPSLSLVLAKFESLSVSTP
WAYGRYREQFGDRYLQTEPARRDRLQALHAGPLLQAMSAGDPVAIAQHLRNDLEAVVLPE
YPQVAELRSVLGNCSGILAAQMSGSGPSVFGIAENPTAAQAAVEQVRQAIADPDLKLWVT
QTISHGIQTETLLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgacgctcgttgctccagccaaaatcaatttctatctggaaattctgggc
gatcgccccgacggtttccacgagctggctatggtgatgcagagcattgccttgggggat
cgtcttcacctacggcagcggcagggacaggggtttcagttgggctgcgatcgcgctgat
ttggaagttgatgagcgcaacttgattctgaaagcagcacagcggttgcagcgatcgttc
ccccaaattggcggcgttgacttttttctcgagaagcggattcccattggtgcagggcta
gcgggcggttcaaccgacggagctgccgctctcgtggggctggatattttcagtgggctg
ggtctgacacaaccagaactggaagcgatcgccgcagaattagggtccgatatgcccttc
tgtgttgccggtggtacccagctttgcaccagtcgcggtgaacaactgacgccgttaccc
cccctaccctctttatccttagtccttgctaagttcgaaagcttgtcggtctcgacgccg
tgggcttacggtcgctaccgcgagcagtttggcgatcgctatctacaaaccgaaccagcg
cggcgcgatcgcctgcaagcgctgcatgccgggccacttctgcaagcgatgagcgctggt
gatcccgttgcgatcgcgcaacatcttcgcaacgatctcgaagcggtggtcttacccgag
tacccccaggtggcggaactgagatctgtgctcgggaactgctctggcattcttgccgcc
caaatgtccggttccgggccaagcgtctttggtattgctgagaatcctactgctgcccaa
gcggccgttgaacaagtccggcaagcgatcgctgatcccgacctgaagctctgggtgacc
caaaccatcagccatgggatccagacggaaactctactgcggtag

DBGET integrated database retrieval system