KEGG   Synechococcus elongatus PCC6301: syc1241_cHelp
Entry
syc1241_c         CDS       T00163                                 

Gene name
hemD
Definition
porphyrin biosynthesis protein HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1352200..1352994)
Genome map
AA seq 264 aa AA seqDB search
MAEQPLIGKTILTTRAAGQSSPFAAQLRAAGAAVIEMPTLEIGPPSSWLPLDEAIAAIAD
FDWLILASANAVEAVQQRLAAQQKSWSDVPCAIAVVGQKTAQVLAAQGGKADYIPPEFIA
ESLVEHFPQPVAGQRLLFPRVETGGREQITQALQSQGAIVVEVPAYESRCPSQIPDDALI
ALRQAHLNLISFTSSKTVRNFCQLMASNLGVDWSARISGVAIASIGPQTSITCQELLGRV
EVEAQEYTLDGLLLAIEQWARQTT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagccgctgatcggtaaaaccattttgacgacgcgagccgcggggcaatct
tcgccctttgccgcacaactgcgggccgctggcgcagccgtgatcgagatgccgacccta
gaaatcgggccgcctagctcttggctgcctctagatgaggcgatcgcggcgatcgcagac
tttgattggctgattttggcctccgccaatgccgttgaagccgtgcaacagcggttagct
gcacagcaaaaaagctggagcgatgttccctgcgcgatcgcggttgtcggtcagaaaacc
gctcaagttctcgctgctcaaggtggtaaggcagattacatcccgccggaatttattgct
gagtcgttggttgaacattttcctcagcctgttgccggtcaacgattgcttttcccacgc
gttgaaaccggcggccgtgagcagattactcaagccctgcagtcgcaaggtgcgatcgtg
gtggaagtgcccgcctacgagtcgcgatgtcccagtcagattcccgatgatgccttgatt
gccttgcggcaggcgcatttgaacttgattagcttcaccagttccaaaacggtgcgcaac
ttctgtcagttgatggcgtcgaatctcggcgtggactggtcagcccgcatctcgggtgtg
gcgatcgcttccatcggtccccagacttcgatcacctgtcaggaactcttgggtcgcgtc
gaagttgaggcacaggagtacactttggacggcctattgttggcgatcgaacaatgggcg
cgccaaaccacgtaa

DBGET integrated database retrieval system