KEGG   Synechococcus elongatus PCC6301: syc1336_dHelp
Entry
syc1336_d         CDS       T00163                                 

Gene name
cysQ
Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    syc1336_d (cysQ)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     syc1336_d (cysQ)
Transfer RNA biogenesis [BR:syc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    syc1336_d (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1447812..1448681
Genome map
AA seq 289 aa AA seqDB search
MSPLQSIAGQPVESVLAIARQVGWEAADIALQFYTAQSEAAPKLWQEGDDPVTAADLAIH
RHVLERLQTAFADQPFGYLSEESDRTALTLPLPEEWVWIIDPLDGTRDFIDHTGEFAVQI
ALTYQQRPVLAVVAIPAQQLLYWAVQGQGCYRETQDGTQTKLTVSDRQEDLILVASRTHR
GDRFQQLLDRLSLPQQIYVGSVGVKIVAIAEQRADVYLSLSGKSAPKDWDMAAPELLLLE
AGGRFSHADGSALRYNTGDISQWGCLIASNGPAHDRLCQEATALLASLD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctctccagtcgatcgccggtcaacccgtcgagtcagttctcgcgatcgcccgt
caagtcggctgggaagcggcagacattgcactgcagttctacaccgctcagtctgaagca
gcaccgaagctgtggcaggagggggatgaccccgtcacggcagcggatttggcaattcat
cgccacgttctggaacggctacaaaccgcttttgccgatcagcccttcggctacctcagc
gaagagagcgatcgcaccgcgctgactttgccactgccggaagagtgggtttggatcatc
gaccccttggatggcacccgcgatttcatcgatcacaccggcgaatttgcggtgcagatt
gccctgacctaccaacagcgcccggtcttggcggtcgtcgcaatacccgctcagcagttg
ctttattgggcggtacaaggccagggctgctaccgcgaaacgcaagacggcactcagacg
aaattgacggtttccgatcgccaagaggatctgattctggttgccagccgaacccatcgg
ggcgatcgcttccagcaattgctcgatcgcctttctttgccgcagcagatttatgtgggc
agtgtcggcgtcaaaattgtcgcgatcgcagaacaacgcgccgatgtttacctctctctc
tcgggtaaatcagccccgaaagattgggacatggccgcccccgagctactcctgctcgaa
gccggtgggcgcttcagccatgccgatggttctgctcttcgctacaacaccggcgatatc
agccagtggggttgcttgattgccagcaacggtcccgcccacgatcgcctctgtcaagaa
gccaccgcactccttgccagcttggactag

DBGET integrated database retrieval system