KEGG   Synechococcus elongatus PCC6301: syc1498_cHelp
Entry
syc1498_c         CDS       T00163                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    syc1498_c (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    syc1498_c (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    syc1498_c (thrC)
Enzymes [BR:syc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     syc1498_c (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1621858..1622958)
Genome map
AA seq 366 aa AA seqDB search
MTATYPSEAQPQSRAHGWPGLIEAYRDYLPVTDTTPIVTLHEGNTPLIPVPTIAREIGRG
VEVFVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAF
VLIPDGFVAQGKLAQALLYGAEVLAIKGNFDRALEIVREVANQYPVTLVNSLNPYRLEGQ
KTAAFELIDVLGEAPDWLCIPMGNAGNISAYWMGFQEYHAKGLSQKLPRMMGFQAAGSAP
LVTGEIVQSPDTIATAIRIGNPANWQRALRVHEESNGAFNAVTDAEILDAYRMLAGQEGI
FCEPASAASVAGMLKCKDEIPDGATIVCVLTGNGLKDPSSAIEFSHTGFKAGIEPDLDIV
AHTMGF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaacgtatccgtctgaagcccaaccccaaagccgtgcccacggttggcccgga
ctgatcgaagcctaccgcgactacctccccgtcaccgacacgacgccgatcgtcacgctg
cacgagggtaatacgcccttgattcctgtgccgacgatcgcccgtgaaattggtcgcggc
gtggaagttttcgtcaaatatgatggcctcaatcccacaggcagctttaaagatcgtggg
atgacgatggcgatcaccaaggccaaagaagcgggtgcaaaagcggttatctgcgccagt
actggcaacacttcggcggcggcagcagcctacgcaagacgtggcggcctgcgtgctttt
gtcttgattccggatggttttgttgcccaaggcaagctagcccaagccctgctctacggg
gcagaagtgctggcgatcaaaggcaacttcgatcgagctctcgaaatcgttcgcgaagtc
gctaaccagtacccagtcaccctcgttaactcgctcaatccctatcgtttagaagggcaa
aaaacagctgcctttgagttgattgatgtgctcggcgaagcccccgattggctctgtatt
cccatgggcaatgcaggcaacatcagtgcctattggatgggctttcaggaatatcatgct
aaggggttgagccaaaaactgccccgcatgatgggttttcaagcggcgggttcagcgcct
ctagtcaccggagaaattgtgcaatcgcccgatacgatcgcaacagcaattcggattggt
aatccagcgaactggcaacgtgccctcagagtgcatgaggaaagtaatggtgccttcaat
gcagtgaccgatgctgaaattcttgatgcctatcgcatgctggctggtcaggagggtatc
ttctgtgagcctgccagtgcagcttccgtcgctggcatgctgaagtgcaaagatgaaatc
ccagacggcgctacgatcgtctgcgttctgactggtaatggcctcaaggatcccagcagt
gcgatcgaatttagccacacaggtttcaaagctggaattgagcctgatttagatatcgtg
gctcacaccatgggcttttaa

DBGET integrated database retrieval system