KEGG   Synechococcus elongatus PCC6301: syc1549_dHelp
Entry
syc1549_d         CDS       T00163                                 

Gene name
desC
Definition
delta-9 acyl-lipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:syc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:syc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1676804..1677640
Genome map
AA seq 278 aa AA seqDB search
MTLAIRPKLAFNWPTALFMVAIHIGALLAFLPANFNWPAVGVMVALYYITGCFGITLGWH
RLISHRSFEVPKWLEYVLVFCGTLAMQHGPIEWIGLHRHHHLHSDQDVDHHDSNKGFLWS
HFLWMIYEIPARTEVDKFTRDIAGDPVYRFFNKYFFGVQVLLGVLLYAWGEAWVGNGWSF
VVWGIFARLVVVYHVTWLVNSATHKFGYRSHESGDQSTNCWWVALLAFGEGWHNNHHAYQ
YSARHGLQWWEFDLTWLIICGLKKVGLARKIKVASPNN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgctatccgacccaagcttgccttcaactggccgaccgccctgttcatggtc
gccattcacattggagcactgttagcgttcctgccggccaactttaactggcccgctgtg
ggcgtgatggttgcgctgtattacattaccggttgttttggcatcaccctaggctggcac
cggctaatttcgcaccgtagctttgaagttcccaaatggctggaatacgtgctggtgttc
tgtggcaccttggccatgcagcacggcccgatcgaatggatcggtctgcaccgccaccat
cacctccactctgaccaagatgtcgatcaccacgactccaacaagggtttcctctggagt
cacttcctgtggatgatctacgaaattccggcccgtacggaagtagacaagttcacgcgc
gatatcgctggcgaccctgtctatcgcttctttaacaaatatttcttcggtgtccaagtc
ctactgggggtacttttgtacgcctggggcgaggcttgggttggcaatggctggtctttc
gtcgtttgggggatcttcgcccgcttggtggtggtctaccacgtcacttggctggtgaac
agtgctacccacaagtttggctaccgctcccatgagtctggcgaccagtccaccaactgc
tggtgggttgcccttctggcctttggtgaaggctggcacaacaaccaccacgcctaccag
tactcggcacgtcatggcctgcagtggtgggaatttgacttgacttggttgatcatctgc
ggcctgaagaaggtgggtctggctcgcaagatcaaagtggcgtctccaaacaactaa

DBGET integrated database retrieval system