KEGG   Synechococcus elongatus PCC6301: syc1798_cHelp
Entry
syc1798_c         CDS       T00163                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1944775..1945566)
Genome map
AA seq 263 aa AA seqDB search
MGVINVTPDSFSDGGQFLDPAIAVAQGQALWQAGADILDIGGQSTRPGAETVPLAVELAR
VIPVVRSLRAELGSKPILSVDTTRVEVAAAALAAGADWINDISGGTFEPEILSLAAERQA
PIVLMHLRGTPQTMQQLTDYDDVVTAVQTSLVERREAAIAAGVQPERIILDPGIGFAKTA
EQNLELLRRQRELTTLGCPLLVGVSRKSFIGKILNQPDPQQRVWGTAAACSAAIAQGADI
LRVHDVAAMVDVARVADAIWRSP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgatcaacgtgacgcccgatagctttagcgatggtggccagttcttagatccc
gcaatcgccgttgcccaaggtcaagcgctctggcaagccggagcggacattctcgacatc
ggtggtcagtcaactcgcccgggagccgaaaccgtgcccttggcggttgagctagcgcgg
gtgatccctgttgtgcgatcgctgcgggcagagctgggatcaaagccgatcctctcggtc
gatacaacgcgggtagaggtcgcggctgcagccctcgcagcaggtgcagactggatcaat
gacatttccggggggactttcgagcctgaaattctctcactggcagccgaacggcaggca
ccgatcgtgttgatgcatctgcgcggcacaccacaaaccatgcagcaactgaccgactac
gacgatgtcgtcacagccgtacaaaccagcttggtagaacggcgtgaggcagcgatcgcg
gcgggggtgcaaccggagcggattattctcgatccggggatcggctttgccaaaacggct
gaacaaaacttggaactcctgcgacgtcagcgagaattgaccacgctcggctgcccgctg
ttggtaggtgtctcccgcaagagctttattggcaaaatccttaatcagcccgatccccag
caacgcgtctgggggacggcagcggcttgtagcgcagcgatcgcccaaggagccgatatt
ttacgagttcacgatgtggcggcgatggtcgatgtggctcgagtggccgatgccatctgg
cgatcgccctaa

DBGET integrated database retrieval system