KEGG   Synechococcus elongatus PCC6301: syc1802_cHelp
Entry
syc1802_c         CDS       T00163                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    syc1802_c (ruvA)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     syc1802_c (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1947439..1948062)
Genome map
AA seq 207 aa AA seqDB search
MIGYLQGSLAGVRKQSGRLLLLLDVQGVGYEVQTPARSLVELPAAGQSLQVFTHLQVRED
QWLLFGFLQMAERDLFRQLISVSGIGPQLGLALLDSLSLAELVQAIVAGNTRLLSRTPGV
GAKTAERLALELRSKLAEWREEAGLLPSATAAPIAAVQEDVEMTLLALGYNNREILQALT
AIAQENLVQSGQPAEDWIREAIAWLSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatctccaaggttctctggctggcgttcgcaagcagagcggccgactcttg
ctcttattagatgtgcagggagttggctacgaagtgcaaacaccagcgcgatcgctggta
gagctgcctgccgctggtcaatccctacaagtgttcacccatcttcaggtccgagaagat
cagtggctgctgtttggtttcttgcaaatggcagagcgcgatctgtttcggcagctgatc
agcgtcagcgggattggcccccagttggggctagcgctgctcgacagtttaagtctggcg
gaattagtgcaggcgatcgtggcgggcaatacgcgtctgctgagccggactcccggcgtt
ggtgcgaagaccgcagaacgactcgccttggagttgcgtagcaaattagcggagtggcgc
gaagaggcgggcctgctccccagtgcgacggcagccccgatcgcagcagtacaggaggat
gtggaaatgaccctgctggcgctgggatacaacaatcgcgaaatcctgcaagccttgacc
gcgatcgcccaagaaaatcttgtccagtcggggcagcccgccgaagattggattcgtgaa
gcgatcgcatggcttagccgttga

DBGET integrated database retrieval system